Desmodus rotundus (common vampire bat): 112307800 Help Entry 112307800         CDS       T05907                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04022   cGMP-PKG signaling pathway dro04270   Vascular smooth muscle contraction dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     112307800 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     112307800 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112307800 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112307800 (NPPC) Cytokines and neuropeptides [BR:dro04052]  Neuropeptides   Neuropeptides (Unclassified)    112307800 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  112307800 NCBI-ProteinID:  XP_024419736 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MHLSQLLACALLLTLLSLLPSEAKPGSPKARRAPLGEMPAHAESGALKKRDKTPGGSGAS FKGEQSRLLRDLRVDTKSRWTRLLQENPTRKKPNTKKGSSKGCFGQKLDRIGALSGLGC NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccaactgctggcctgcgccctgctgctcactctactgtcgctcctgccc tccgaagccaagcccgggtcgccgaaggcccggcgagctccgctgggggagatgccggcc catgctgagagcggcgctctgaagaagcgcgacaagactcccggaggcagcggcgccagc ttcaaaggcgagcagtcgcgactgctccgggacctgcgcgtggacaccaagtcgcggtgg acccgccttctgcaggagaaccccacacgcaagaaaccaaacaccaagaagggctcgtcc aagggctgcttcggccaaaagctggaccggattggcgccttgagcggcctgggatgttag

DBGET integrated database retrieval system