Desmodus rotundus (common vampire bat): 112308268 Help Entry 112308268         CDS       T05907                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04072   Phospholipase D signaling pathway dro04140   Autophagy - animal dro04150   mTOR signaling pathway dro04151   PI3K-Akt signaling pathway dro04152   AMPK signaling pathway dro04211   Longevity regulating pathway dro04218   Cellular senescence dro04714   Thermogenesis dro04910   Insulin signaling pathway dro04919   Thyroid hormone signaling pathway dro05163   Human cytomegalovirus infection dro05165   Human papillomavirus infection dro05168   Herpes simplex virus 1 infection dro05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     112308268 (RHEB)    04151 PI3K-Akt signaling pathway     112308268 (RHEB)    04152 AMPK signaling pathway     112308268 (RHEB)    04150 mTOR signaling pathway     112308268 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112308268 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     112308268 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112308268 (RHEB)    04919 Thyroid hormone signaling pathway     112308268 (RHEB)   09149 Aging    04211 Longevity regulating pathway     112308268 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     112308268 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     112308268 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     112308268 (RHEB)    05163 Human cytomegalovirus infection     112308268 (RHEB)    05165 Human papillomavirus infection     112308268 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dro04031]     112308268 (RHEB) GTP-binding proteins [BR:dro04031]  Small (monomeric) G-proteins   Ras Family    Rheb     112308268 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 DUF1842 Motif Other DBs NCBI-GeneID:  112308268 NCBI-ProteinID:  XP_024420217 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MRPLFLMQTVVPRQEVTQLDQAEVVVSGDYLQVQSGKSSLTIQFVEGQFVDSYDPTIENT FTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGK LLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRR IILEAEKIDGAASQGKSSCSMM NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgcgcccgttgtttctgatgcagacagtggtcccacggcaggaggtgactcagctcgac caagctgaagttgtagtgtcgggtgactatcttcaggtacaatctgggaaatcctcgttg acgattcagtttgtggaaggccagtttgttgactcctacgacccaaccatagagaacacg ttcacgaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagacacagct gggcaggatgaatactccatctttcctcagacatactccatagacatcaatggttatatt cttgtgtattctgttacgtcaatcaaaagttttgaggtgatcaaagtgatccacggcaaa ctgttggatatggtggggaaggtgcagatccctattatgttggtcgggaataagaaggac ctacatatggaaagggtgatcagttacgaagaagggaaggcgttagcagaatcttggaac gcagcgtttttggaatcgtctgctaaagaaaatcaaactgctgttgacgtttttaggagg ataattttggaggcagaaaaaattgatggggctgcttcacaaggaaagtcttcctgctcg atgatgtga

DBGET integrated database retrieval system