Desmodus rotundus (common vampire bat): 112309304 Help Entry 112309304         CDS       T05907                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04382   Cornified envelope formation dro05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dro00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112309304  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112309304  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112309304 Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of microglial cells    112309304 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 Motif Other DBs NCBI-GeneID:  112309304 NCBI-ProteinID:  XP_024421284 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MPSHMEHTMENMILKFHKLAEDTGCLTKEDLRVFAEKESPEILENLAVDKIMKDLNQCQD GRLGSRTFFLLIAGLPIICNNYFVVHTCEAEEKEVGSTEKLILP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgccctcccacatggaacacaccatggaaaacatgatattaaagtttcacaaacttgct gaggatacaggctgcttaacaaaggaggacctgagagtatttgcggaaaaggagtcccca gaaatcttggaaaatctggctgtggacaaaataatgaaggacctgaaccagtgccaagat ggcagactgggttccagaactttttttctgctaattgctgggctccccatcatttgcaac aattactttgtagtacacacatgtgaagcagaagaaaaagaagtaggcagcactgagaag ttaatcctgccctga

DBGET integrated database retrieval system