Desmodus rotundus (common vampire bat): 112309570 Help Entry 112309570         CDS       T05907                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04014   Ras signaling pathway dro04137   Mitophagy - animal dro04144   Endocytosis dro04145   Phagosome dro04148   Efferocytosis dro04962   Vasopressin-regulated water reabsorption dro05014   Amyotrophic lateral sclerosis dro05022   Pathways of neurodegeneration - multiple diseases dro05132   Salmonella infection dro05146   Amoebiasis dro05152   Tuberculosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112309570 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112309570 (RAB5A)    04145 Phagosome     112309570 (RAB5A)    04137 Mitophagy - animal     112309570 (RAB5A)    04148 Efferocytosis     112309570 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     112309570 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112309570 (RAB5A)    05152 Tuberculosis     112309570 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     112309570 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112309570 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     112309570 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dro04131]     112309570 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112309570 (RAB5A)    04031 GTP-binding proteins [BR:dro04031]     112309570 (RAB5A) Membrane trafficking [BR:dro04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     112309570 (RAB5A)  Endosome - Lysosome transport     112309570 (RAB5A) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112309570 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    112309570 (RAB5A)   Exosomal proteins of colorectal cancer cells    112309570 (RAB5A)   Exosomal proteins of bladder cancer cells    112309570 (RAB5A) GTP-binding proteins [BR:dro04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     112309570 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  112309570 NCBI-ProteinID:  XP_024421532 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSSLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacctaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagag cgataccatagcctagcaccaatgtactacagaggagcacaagcggccatagttgtatat gacatcacaaatgaggaatcctttgccagagccaaaaattgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatctggaaacaaggctgaccttgcaaataaa agagctgttgatttccaggaagcacagtcttatgcagatgacaacagttcattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaagaag ttgccaaagaatgaaccacagaatccaggagcaaattctgcccggggaagaggagtagac cttactgaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system