Desmodus rotundus (common vampire bat): 112309989 Help Entry 112309989         CDS       T05907                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04080   Neuroactive ligand-receptor interaction dro04081   Hormone signaling dro04911   Insulin secretion dro04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112309989 (CCK)    04081 Hormone signaling     112309989 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     112309989 (CCK)   09154 Digestive system    04972 Pancreatic secretion     112309989 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112309989 (CCK) Cytokines and neuropeptides [BR:dro04052]  Neuropeptides   GPCR binding    112309989 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Metal_resist Motif Other DBs NCBI-GeneID:  112309989 NCBI-ProteinID:  XP_024422007 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MNSGVCLCVLMAALAAGALAQPVPPPDSEGPGAQQGEEAARRQLRAAQRLDGEPRAHLGA LLARYIQPARKAPSGRMSLIKNLQNRDPRYNTGDRDYMGWMDFGRRSVEEYEYPS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacagcggcgtgtgtctgtgcgtgctgatggcggccctggcggcaggcgccctggcg cagccggtgcccccgccggactcggagggccctggggcacagcagggggaggaggcggcc cggaggcagctgagggcagcgcagaggctggacggcgagccccgagcgcacctgggcgcg ctgctggccagatacatccagccggcccggaaagctccttctggccgaatgtccctgatc aagaacttgcagaaccgggaccccagatacaacacaggtgaccgggactacatgggctgg atggacttcggccggcgcagcgtcgaggagtacgagtacccctcctag

DBGET integrated database retrieval system