Desmodus rotundus (common vampire bat): 112310132
Help
Entry
112310132 CDS
T05907
Symbol
BAX
Name
(RefSeq) apoptosis regulator BAX
KO
K02159
apoptosis regulator BAX
Organism
dro
Desmodus rotundus (common vampire bat)
Pathway
dro01521
EGFR tyrosine kinase inhibitor resistance
dro01522
Endocrine resistance
dro01524
Platinum drug resistance
dro04071
Sphingolipid signaling pathway
dro04115
p53 signaling pathway
dro04141
Protein processing in endoplasmic reticulum
dro04210
Apoptosis
dro04211
Longevity regulating pathway
dro04215
Apoptosis - multiple species
dro04217
Necroptosis
dro04722
Neurotrophin signaling pathway
dro04932
Non-alcoholic fatty liver disease
dro04933
AGE-RAGE signaling pathway in diabetic complications
dro05012
Parkinson disease
dro05014
Amyotrophic lateral sclerosis
dro05016
Huntington disease
dro05020
Prion disease
dro05022
Pathways of neurodegeneration - multiple diseases
dro05132
Salmonella infection
dro05152
Tuberculosis
dro05160
Hepatitis C
dro05161
Hepatitis B
dro05162
Measles
dro05163
Human cytomegalovirus infection
dro05164
Influenza A
dro05165
Human papillomavirus infection
dro05166
Human T-cell leukemia virus 1 infection
dro05167
Kaposi sarcoma-associated herpesvirus infection
dro05168
Herpes simplex virus 1 infection
dro05169
Epstein-Barr virus infection
dro05170
Human immunodeficiency virus 1 infection
dro05200
Pathways in cancer
dro05202
Transcriptional misregulation in cancer
dro05203
Viral carcinogenesis
dro05210
Colorectal cancer
dro05212
Pancreatic cancer
dro05213
Endometrial cancer
dro05214
Glioma
dro05216
Thyroid cancer
dro05217
Basal cell carcinoma
dro05218
Melanoma
dro05220
Chronic myeloid leukemia
dro05222
Small cell lung cancer
dro05223
Non-small cell lung cancer
dro05224
Breast cancer
dro05225
Hepatocellular carcinoma
dro05226
Gastric cancer
dro05417
Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
dro00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
112310132 (BAX)
09130 Environmental Information Processing
09132 Signal transduction
04071 Sphingolipid signaling pathway
112310132 (BAX)
09140 Cellular Processes
09143 Cell growth and death
04210 Apoptosis
112310132 (BAX)
04215 Apoptosis - multiple species
112310132 (BAX)
04217 Necroptosis
112310132 (BAX)
04115 p53 signaling pathway
112310132 (BAX)
09150 Organismal Systems
09156 Nervous system
04722 Neurotrophin signaling pathway
112310132 (BAX)
09149 Aging
04211 Longevity regulating pathway
112310132 (BAX)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
112310132 (BAX)
05202 Transcriptional misregulation in cancer
112310132 (BAX)
05203 Viral carcinogenesis
112310132 (BAX)
09162 Cancer: specific types
05210 Colorectal cancer
112310132 (BAX)
05212 Pancreatic cancer
112310132 (BAX)
05225 Hepatocellular carcinoma
112310132 (BAX)
05226 Gastric cancer
112310132 (BAX)
05214 Glioma
112310132 (BAX)
05216 Thyroid cancer
112310132 (BAX)
05220 Chronic myeloid leukemia
112310132 (BAX)
05217 Basal cell carcinoma
112310132 (BAX)
05218 Melanoma
112310132 (BAX)
05213 Endometrial cancer
112310132 (BAX)
05224 Breast cancer
112310132 (BAX)
05222 Small cell lung cancer
112310132 (BAX)
05223 Non-small cell lung cancer
112310132 (BAX)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
112310132 (BAX)
05170 Human immunodeficiency virus 1 infection
112310132 (BAX)
05161 Hepatitis B
112310132 (BAX)
05160 Hepatitis C
112310132 (BAX)
05164 Influenza A
112310132 (BAX)
05162 Measles
112310132 (BAX)
05168 Herpes simplex virus 1 infection
112310132 (BAX)
05163 Human cytomegalovirus infection
112310132 (BAX)
05167 Kaposi sarcoma-associated herpesvirus infection
112310132 (BAX)
05169 Epstein-Barr virus infection
112310132 (BAX)
05165 Human papillomavirus infection
112310132 (BAX)
09171 Infectious disease: bacterial
05132 Salmonella infection
112310132 (BAX)
05152 Tuberculosis
112310132 (BAX)
09164 Neurodegenerative disease
05012 Parkinson disease
112310132 (BAX)
05014 Amyotrophic lateral sclerosis
112310132 (BAX)
05016 Huntington disease
112310132 (BAX)
05020 Prion disease
112310132 (BAX)
05022 Pathways of neurodegeneration - multiple diseases
112310132 (BAX)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
112310132 (BAX)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
112310132 (BAX)
04933 AGE-RAGE signaling pathway in diabetic complications
112310132 (BAX)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
112310132 (BAX)
01524 Platinum drug resistance
112310132 (BAX)
01522 Endocrine resistance
112310132 (BAX)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
dro03029
]
112310132 (BAX)
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
dro02000
]
112310132 (BAX)
Mitochondrial biogenesis [BR:
dro03029
]
Mitochondrial quality control factors
Mitochondrial dynamics
Fission and Fusion factors
112310132 (BAX)
Transporters [BR:
dro02000
]
Other transporters
Pores ion channels [TC:
1
]
112310132 (BAX)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Bcl-2
Motif
Other DBs
NCBI-GeneID:
112310132
NCBI-ProteinID:
XP_024422134
LinkDB
All DBs
Position
Unknown
AA seq
193 aa
AA seq
DB search
MDGSGEQPTDGGPTSSEQIMKTGALLLQGFIRDRAGRIGGDTPELALEPRVPPDASTKKL
SDCLKRIGDELDSNVELQRMIAAVDTDSPREVFFRVASEMFSDGNFNWGRVVALFYFASK
LVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKKMG
NT seq
582 nt
NT seq
+upstream
nt +downstream
nt
atggacgggtccggggagcaacccacagacggggggcccaccagctctgagcagatcatg
aagacaggggcccttttacttcagggtttcatccgggatcgagcagggagaatcggggga
gacacaccggagctggccctggagcccagggtgcccccagatgcatccaccaagaagctg
agcgattgtctcaagcgcattggagatgaactggacagtaatgtggagctgcagaggatg
atcgcggctgtggacacagactccccccgcgaggtctttttccgagtggcgtccgaaatg
ttttctgacggcaacttcaactggggccgggttgtcgccctcttctactttgccagcaag
ctggtgctcaaggccctgtgcaccaaagtgcccgagctgatcaggaccatcatgggctgg
acgctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggac
ggcctcctctcctacttcgggacacccacgtggcagacagtgaccatcttcgtggccgga
gtgctcactgcctcgctcaccatctggaagaagatgggctga
DBGET
integrated database retrieval system