Desmodus rotundus (common vampire bat): 112311283 Help Entry 112311283         CDS       T05907                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04613   Neutrophil extracellular trap formation dro05034   Alcoholism dro05202   Transcriptional misregulation in cancer dro05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dro00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112311283  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112311283   09163 Immune disease    05322 Systemic lupus erythematosus     112311283   09165 Substance dependence    05034 Alcoholism     112311283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dro03036]     112311283   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112311283 Chromosome and associated proteins [BR:dro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112311283 Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112311283 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  112311283 NCBI-ProteinID:  XP_024423364 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MVHTKQTARNSAGGKAPRKQLATKAALKSAPSAGGVKKPHRYRPGTVALREIRHYQKSTE LLICKLPFQRLVREIAQSFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLALRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggttcatacaaagcagactgcccgcaactccgcaggtggtaaagcaccgaggaagcaa ctggctaccaaagccgctctcaagagtgcaccctctgctggaggggtgaagaaacctcat cgttacaggcctggtactgtggcacttcgtgaaattagacattatcagaagtccactgaa cttctgatttgcaagcttcccttccagcgtctggtgcgagaaattgctcagagcttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaagcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcactccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system