Desmodus rotundus (common vampire bat): 112313634 Help Entry 112313634         CDS       T05907                                  Name (RefSeq) histone H3.1 isoform X1   KO K11253   histone H3 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04613   Neutrophil extracellular trap formation dro05034   Alcoholism dro05202   Transcriptional misregulation in cancer dro05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dro00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112313634  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112313634   09163 Immune disease    05322 Systemic lupus erythematosus     112313634   09165 Substance dependence    05034 Alcoholism     112313634  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dro03036]     112313634   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112313634 Chromosome and associated proteins [BR:dro03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112313634 Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112313634 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  112313634 NCBI-ProteinID:  XP_024426002 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcacggaccaagcagacggcgcgcaagtccacgggcgggaaggccccgcgcaaacag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtgggcctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

DBGET integrated database retrieval system