Desmodus rotundus (common vampire bat): 112313707 Help Entry 112313707         CDS       T05907                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism dro  Desmodus rotundus (common vampire bat) Pathway dro01521   EGFR tyrosine kinase inhibitor resistance dro01522   Endocrine resistance dro04010   MAPK signaling pathway dro04012   ErbB signaling pathway dro04014   Ras signaling pathway dro04015   Rap1 signaling pathway dro04062   Chemokine signaling pathway dro04068   FoxO signaling pathway dro04071   Sphingolipid signaling pathway dro04072   Phospholipase D signaling pathway dro04137   Mitophagy - animal dro04140   Autophagy - animal dro04150   mTOR signaling pathway dro04151   PI3K-Akt signaling pathway dro04210   Apoptosis dro04211   Longevity regulating pathway dro04213   Longevity regulating pathway - multiple species dro04218   Cellular senescence dro04360   Axon guidance dro04370   VEGF signaling pathway dro04371   Apelin signaling pathway dro04540   Gap junction dro04550   Signaling pathways regulating pluripotency of stem cells dro04625   C-type lectin receptor signaling pathway dro04650   Natural killer cell mediated cytotoxicity dro04660   T cell receptor signaling pathway dro04662   B cell receptor signaling pathway dro04664   Fc epsilon RI signaling pathway dro04714   Thermogenesis dro04720   Long-term potentiation dro04722   Neurotrophin signaling pathway dro04725   Cholinergic synapse dro04726   Serotonergic synapse dro04730   Long-term depression dro04810   Regulation of actin cytoskeleton dro04910   Insulin signaling pathway dro04912   GnRH signaling pathway dro04915   Estrogen signaling pathway dro04916   Melanogenesis dro04917   Prolactin signaling pathway dro04919   Thyroid hormone signaling pathway dro04921   Oxytocin signaling pathway dro04926   Relaxin signaling pathway dro04929   GnRH secretion dro04933   AGE-RAGE signaling pathway in diabetic complications dro04935   Growth hormone synthesis, secretion and action dro05010   Alzheimer disease dro05022   Pathways of neurodegeneration - multiple diseases dro05034   Alcoholism dro05160   Hepatitis C dro05161   Hepatitis B dro05163   Human cytomegalovirus infection dro05165   Human papillomavirus infection dro05166   Human T-cell leukemia virus 1 infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05170   Human immunodeficiency virus 1 infection dro05200   Pathways in cancer dro05203   Viral carcinogenesis dro05205   Proteoglycans in cancer dro05206   MicroRNAs in cancer dro05207   Chemical carcinogenesis - receptor activation dro05208   Chemical carcinogenesis - reactive oxygen species dro05210   Colorectal cancer dro05211   Renal cell carcinoma dro05213   Endometrial cancer dro05214   Glioma dro05215   Prostate cancer dro05216   Thyroid cancer dro05218   Melanoma dro05219   Bladder cancer dro05220   Chronic myeloid leukemia dro05221   Acute myeloid leukemia dro05223   Non-small cell lung cancer dro05224   Breast cancer dro05225   Hepatocellular carcinoma dro05226   Gastric cancer dro05230   Central carbon metabolism in cancer dro05231   Choline metabolism in cancer dro05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112313707 (NRAS)    04012 ErbB signaling pathway     112313707 (NRAS)    04014 Ras signaling pathway     112313707 (NRAS)    04015 Rap1 signaling pathway     112313707 (NRAS)    04370 VEGF signaling pathway     112313707 (NRAS)    04371 Apelin signaling pathway     112313707 (NRAS)    04068 FoxO signaling pathway     112313707 (NRAS)    04072 Phospholipase D signaling pathway     112313707 (NRAS)    04071 Sphingolipid signaling pathway     112313707 (NRAS)    04151 PI3K-Akt signaling pathway     112313707 (NRAS)    04150 mTOR signaling pathway     112313707 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112313707 (NRAS)    04137 Mitophagy - animal     112313707 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112313707 (NRAS)    04218 Cellular senescence     112313707 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112313707 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     112313707 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112313707 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112313707 (NRAS)    04650 Natural killer cell mediated cytotoxicity     112313707 (NRAS)    04660 T cell receptor signaling pathway     112313707 (NRAS)    04662 B cell receptor signaling pathway     112313707 (NRAS)    04664 Fc epsilon RI signaling pathway     112313707 (NRAS)    04062 Chemokine signaling pathway     112313707 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112313707 (NRAS)    04929 GnRH secretion     112313707 (NRAS)    04912 GnRH signaling pathway     112313707 (NRAS)    04915 Estrogen signaling pathway     112313707 (NRAS)    04917 Prolactin signaling pathway     112313707 (NRAS)    04921 Oxytocin signaling pathway     112313707 (NRAS)    04926 Relaxin signaling pathway     112313707 (NRAS)    04935 Growth hormone synthesis, secretion and action     112313707 (NRAS)    04919 Thyroid hormone signaling pathway     112313707 (NRAS)    04916 Melanogenesis     112313707 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     112313707 (NRAS)    04726 Serotonergic synapse     112313707 (NRAS)    04720 Long-term potentiation     112313707 (NRAS)    04730 Long-term depression     112313707 (NRAS)    04722 Neurotrophin signaling pathway     112313707 (NRAS)   09158 Development and regeneration    04360 Axon guidance     112313707 (NRAS)   09149 Aging    04211 Longevity regulating pathway     112313707 (NRAS)    04213 Longevity regulating pathway - multiple species     112313707 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     112313707 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112313707 (NRAS)    05206 MicroRNAs in cancer     112313707 (NRAS)    05205 Proteoglycans in cancer     112313707 (NRAS)    05207 Chemical carcinogenesis - receptor activation     112313707 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     112313707 (NRAS)    05203 Viral carcinogenesis     112313707 (NRAS)    05230 Central carbon metabolism in cancer     112313707 (NRAS)    05231 Choline metabolism in cancer     112313707 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112313707 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     112313707 (NRAS)    05225 Hepatocellular carcinoma     112313707 (NRAS)    05226 Gastric cancer     112313707 (NRAS)    05214 Glioma     112313707 (NRAS)    05216 Thyroid cancer     112313707 (NRAS)    05221 Acute myeloid leukemia     112313707 (NRAS)    05220 Chronic myeloid leukemia     112313707 (NRAS)    05218 Melanoma     112313707 (NRAS)    05211 Renal cell carcinoma     112313707 (NRAS)    05219 Bladder cancer     112313707 (NRAS)    05215 Prostate cancer     112313707 (NRAS)    05213 Endometrial cancer     112313707 (NRAS)    05224 Breast cancer     112313707 (NRAS)    05223 Non-small cell lung cancer     112313707 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112313707 (NRAS)    05170 Human immunodeficiency virus 1 infection     112313707 (NRAS)    05161 Hepatitis B     112313707 (NRAS)    05160 Hepatitis C     112313707 (NRAS)    05163 Human cytomegalovirus infection     112313707 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     112313707 (NRAS)    05165 Human papillomavirus infection     112313707 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     112313707 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     112313707 (NRAS)   09165 Substance dependence    05034 Alcoholism     112313707 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112313707 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112313707 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112313707 (NRAS)    01522 Endocrine resistance     112313707 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dro04131]     112313707 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112313707 (NRAS)    04031 GTP-binding proteins [BR:dro04031]     112313707 (NRAS) Membrane trafficking [BR:dro04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112313707 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112313707 (NRAS) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112313707 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112313707 (NRAS)   Exosomal proteins of breast cancer cells    112313707 (NRAS)   Exosomal proteins of colorectal cancer cells    112313707 (NRAS) GTP-binding proteins [BR:dro04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112313707 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  112313707 NCBI-ProteinID:  XP_024426079 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac cgaaaacaggtggttatagacggtgagacctgcctgctggacatactggatacagctgga caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcagatattaacctgtacagggaacagatt aagcgagtcaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccgacaaggacagttgacacaaaacaagcccatgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatccgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system