Desmodus rotundus (common vampire bat): 112314881 Help Entry 112314881         CDS       T05907                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro03272   Virion - Hepatitis viruses dro04382   Cornified envelope formation dro04514   Cell adhesion molecules dro04530   Tight junction dro04670   Leukocyte transendothelial migration dro05160   Hepatitis C Brite KEGG Orthology (KO) [BR:dro00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     112314881 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     112314881 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     112314881 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     112314881 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     112314881 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     112314881 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dro03037]     112314881 (CLDN4)    04147 Exosome [BR:dro04147]     112314881 (CLDN4)    04515 Cell adhesion molecules [BR:dro04515]     112314881 (CLDN4) Cilium and associated proteins [BR:dro03037]  Other cilia and associated proteins   Stereociliary proteins    112314881 (CLDN4) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    112314881 (CLDN4)   Exosomal proteins of colorectal cancer cells    112314881 (CLDN4) Cell adhesion molecules [BR:dro04515]  Immunoglobulin superfamily   L1 family    112314881 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 Clc-like DUF7319 Motif Other DBs NCBI-GeneID:  112314881 NCBI-ProteinID:  XP_024427244 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSMLALPQDLQAARALIVICIIVAVLGVLLSVVGGKCTNCVEDESTKAKIMIV AGVVFLLAGLLVMVPVSWTANTIIRDFYNPLVAAGQKREIGASLYIGWAAAGLLMLGGAL LCCNCPPRADKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctacaggtgatggggattgcgctggccgtgctgggctggctgggc gccatactgagctgcgcgctgcccatgtggcgggtgacggcgttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactctatgctggcgctgccgcaggacctgcaggcggcc cgcgccctcattgtcatctgcatcatcgtggctgtgctgggcgtgctgctgtctgttgtg ggtggcaagtgcaccaactgcgtggaggatgagagcaccaaagccaagatcatgattgtg gcaggcgtggtgttcctcctggccggcctgctggtgatggtacccgtgtcctggacagcc aacaccatcatccgtgatttctacaatcctctggtggctgccgggcagaagcgggaaata ggggcctcactctacataggctgggcggctgcaggtctgctgatgctcggtggggctctt ctctgctgcaactgcccacctcgtgctgacaagccctactccgccaagtactctgctgcc cgttccgcccctgccagcaactacgtgtaa

DBGET integrated database retrieval system