KEGG   Desmodus rotundus (common vampire bat): 112319549
Entry
112319549         CDS       T05907                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04071  Sphingolipid signaling pathway
dro04145  Phagocytosis
dro04148  Efferocytosis
dro04151  PI3K-Akt signaling pathway
dro04310  Wnt signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04510  Focal adhesion
dro04517  IgSF CAM signaling
dro04518  Integrin signaling
dro04519  Cadherin signaling
dro04520  Adherens junction
dro04530  Tight junction
dro04613  Neutrophil extracellular trap formation
dro04620  Toll-like receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagosome formation
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04810  Regulation of actin cytoskeleton
dro04932  Non-alcoholic fatty liver disease
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04972  Pancreatic secretion
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05100  Bacterial invasion of epithelial cells
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05163  Human cytomegalovirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05208  Chemical carcinogenesis - reactive oxygen species
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05231  Choline metabolism in cancer
dro05415  Diabetic cardiomyopathy
dro05416  Viral myocarditis
dro05417  Lipid and atherosclerosis
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112319549 (RAC1)
   04014 Ras signaling pathway
    112319549 (RAC1)
   04015 Rap1 signaling pathway
    112319549 (RAC1)
   04310 Wnt signaling pathway
    112319549 (RAC1)
   04370 VEGF signaling pathway
    112319549 (RAC1)
   04071 Sphingolipid signaling pathway
    112319549 (RAC1)
   04024 cAMP signaling pathway
    112319549 (RAC1)
   04151 PI3K-Akt signaling pathway
    112319549 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    112319549 (RAC1)
   04518 Integrin signaling
    112319549 (RAC1)
   04519 Cadherin signaling
    112319549 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    112319549 (RAC1)
   04148 Efferocytosis
    112319549 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112319549 (RAC1)
   04520 Adherens junction
    112319549 (RAC1)
   04530 Tight junction
    112319549 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112319549 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112319549 (RAC1)
   04620 Toll-like receptor signaling pathway
    112319549 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    112319549 (RAC1)
   04662 B cell receptor signaling pathway
    112319549 (RAC1)
   04664 Fc epsilon RI signaling pathway
    112319549 (RAC1)
   04666 Fc gamma R-mediated phagosome formation
    112319549 (RAC1)
   04670 Leukocyte transendothelial migration
    112319549 (RAC1)
   04062 Chemokine signaling pathway
    112319549 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    112319549 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112319549 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    112319549 (RAC1)
   04380 Osteoclast differentiation
    112319549 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112319549 (RAC1)
   05205 Proteoglycans in cancer
    112319549 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    112319549 (RAC1)
   05203 Viral carcinogenesis
    112319549 (RAC1)
   05231 Choline metabolism in cancer
    112319549 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112319549 (RAC1)
   05212 Pancreatic cancer
    112319549 (RAC1)
   05211 Renal cell carcinoma
    112319549 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112319549 (RAC1)
   05163 Human cytomegalovirus infection
    112319549 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112319549 (RAC1)
   05169 Epstein-Barr virus infection
    112319549 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112319549 (RAC1)
   05135 Yersinia infection
    112319549 (RAC1)
   05100 Bacterial invasion of epithelial cells
    112319549 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112319549 (RAC1)
   05020 Prion disease
    112319549 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    112319549 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112319549 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    112319549 (RAC1)
   05415 Diabetic cardiomyopathy
    112319549 (RAC1)
   05416 Viral myocarditis
    112319549 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112319549 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112319549 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112319549 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112319549 (RAC1)
   04031 GTP-binding proteins [BR:dro04031]
    112319549 (RAC1)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    112319549 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    112319549 (RAC1)
  Macropinocytosis
   Ras GTPases
    112319549 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    112319549 (RAC1)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112319549 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   112319549 (RAC1)
  Exosomal proteins of colorectal cancer cells
   112319549 (RAC1)
  Exosomal proteins of bladder cancer cells
   112319549 (RAC1)
GTP-binding proteins [BR:dro04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112319549 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 112319549
NCBI-ProteinID: XP_024432621
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaagacctgcctgctg
atcagctacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatactgctgga
caagaggattatgacagattacgtcccctatcctacccgcagacagacgtgttcttaatt
tgcttttctcttgtgagtcctgcatcatttgagaatgtccgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacactcccatcatcctggtggggactaagctcgatctcagg
gatgacaaagacacgatcgagaaactgaaggagaagaagctgacacccatcacctacccg
cagggcttagccatggctaaggagatcggtgccgtcaaatacctggagtgctcggctctc
acacagcgaggcctcaagacagtgtttgatgaagccattcgagctgttctctgcccacct
cccgtcaagaagaggaagagaaagtgcctgctgttgtag

DBGET integrated database retrieval system