Desmodus rotundus (common vampire bat): 112321317 Help Entry 112321317         CDS       T05907                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro02010   ABC transporters dro05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     112321317 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     112321317 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dro02000]     112321317 (DEFB1)    03037 Cilium and associated proteins [BR:dro03037]     112321317 (DEFB1) Transporters [BR:dro02000]  Other transporters   Pores ion channels [TC:1]    112321317 (DEFB1) Cilium and associated proteins [BR:dro03037]  Motile cilia and associated proteins   Sperm associated proteins    112321317 (DEFB1) SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Scoloptoxin_N Motif Other DBs NCBI-GeneID:  112321317 NCBI-ProteinID:  XP_024434494 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MKVLYLLLLSLYLLFSLIAPGAGLTALFHRYPEYECVRKGGTCNFSPCPRFTRIDGACYQ GRAKCCV NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgttgtacttgctgttgctgtctctctacctcctcttctccctgatagcccca ggtgcgggcctcacggccctgttccacaggtacccggagtacgagtgtgtcagaaagggc gggacctgcaacttctctccctgcccgcgcttcaccaggatcgatggcgcctgctaccag gggagggccaagtgctgcgtctga

DBGET integrated database retrieval system