Dactylosporangium roseum: Drose_07140 Help Entry Drose_07140       CDS       T08480                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism dros  Dactylosporangium roseum Pathway dros00190   Oxidative phosphorylation dros01100   Metabolic pathways Module dros_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dros00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Drose_07140 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dros00194]     Drose_07140 (atpE) Photosynthesis proteins [BR:dros00194]  Photosystem and electron transport system   F-type ATPase [OT]    Drose_07140 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UWZ38030 LinkDB All DBs Position 1372852..1373076 Genome browser AA seq 74 aa AA seqDB search MTLAEVSGSLSAIGYGLAAIGPGIGVGIVFASYIQATARQPESAGLTRTYMFLGFAVVEA LALLGIAFGFVFRS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaccctggcagaagtcagcggtagcctcagcgccatcggttacggcctcgccgccatc ggccctggcatcggcgtcggtatcgtcttcgcctcgtacatccaggccaccgcccgccag cccgagtcggccggtctgacccgtacgtacatgttcctcggcttcgccgtggtcgaggcg ctcgccctgctgggtatcgccttcggcttcgtgttccgtagctag

DBGET integrated database retrieval system