Dactylosporangium roseum: Drose_14690 Help Entry Drose_14690       CDS       T08480                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism dros  Dactylosporangium roseum Pathway dros00253   Tetracycline biosynthesis dros01056   Biosynthesis of type II polyketide backbone dros01100   Metabolic pathways dros01110   Biosynthesis of secondary metabolites Module dros_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:dros00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Drose_14690    00253 Tetracycline biosynthesis     Drose_14690  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:dros01004]     Drose_14690    01008 Polyketide biosynthesis proteins [BR:dros01008]     Drose_14690 Lipid biosynthesis proteins [BR:dros01004]  Polyketide synthase   Component type    Drose_14690 Polyketide biosynthesis proteins [BR:dros01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Drose_14690     Nonaketide PKS      Drose_14690     Decaketide PKS      Drose_14690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UWZ39368 LinkDB All DBs Position complement(3138657..3138941) Genome browser AA seq 94 aa AA seqDB search MSHITFEDLKLILIECAGQDEQADLGVEAIDTPFADLGYDSLAVLEAAAMAGRRYGVALT DDVVQAIRTPGDFLATVNGAPAVPVAAPAKETTA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgagccacatcaccttcgaggacctgaagctgatcctcatcgagtgcgccgggcaggac gagcaggcggacctgggcgtcgaggcgatcgacactccgttcgccgacctcggctacgac tcgctcgccgtgctggaagcggccgccatggccggtcgccgctacggcgtggcgctgacc gacgacgtcgttcaggccatccgcaccccgggcgacttcctcgccaccgtcaacggcgca ccggcggtgcccgttgccgcgccggccaaggagacgacggcgtga

DBGET integrated database retrieval system