Dactylosporangium roseum: Drose_24325 Help Entry Drose_24325       CDS       T08480                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism dros  Dactylosporangium roseum Pathway dros00253   Tetracycline biosynthesis dros01056   Biosynthesis of type II polyketide backbone dros01100   Metabolic pathways dros01110   Biosynthesis of secondary metabolites Module dros_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:dros00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Drose_24325    00253 Tetracycline biosynthesis     Drose_24325  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:dros01004]     Drose_24325    01008 Polyketide biosynthesis proteins [BR:dros01008]     Drose_24325 Lipid biosynthesis proteins [BR:dros01004]  Polyketide synthase   Component type    Drose_24325 Polyketide biosynthesis proteins [BR:dros01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Drose_24325     Nonaketide PKS      Drose_24325     Decaketide PKS      Drose_24325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding AIRC DUF7080 Imm53 Motif Other DBs NCBI-ProteinID:  UWZ34352 LinkDB All DBs Position complement(5252293..5252547) Genome browser AA seq 84 aa AA seqDB search MIVTVEDVRRILIACSGAPEVEVADADFADTSLEDLGYDSLALMESAATIEQEYGVRVSD ETFAAAKTPRELTEIVESAAKAAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgattgtcaccgtcgaggacgtccgccgcatcctgatcgcgtgctccggcgcgccggag gtcgaggtcgccgacgccgacttcgccgacaccagcctcgaggacctcggctacgactcg ctcgcgctcatggagtcggccgcgacgatcgagcaggagtacggcgtgcgggtttcggac gagacgttcgcggccgcgaagacgccgcgcgagctgaccgagatcgtcgagtcggccgcg aaggcggcggcatga

DBGET integrated database retrieval system