KEGG   Devosia rhodophyticola: PSQ90_11935
Entry
PSQ90_11935       CDS       T09920                                 
Name
(GenBank) CHASE3 domain-containing protein
Organism
drp  Devosia rhodophyticola
SSDB
Motif
Pfam: CHASE3 HisKA_2 HATPase_c HATPase_c_2 HWE_HK AI-2E_transport DUF948
Other DBs
NCBI-ProteinID: WDR05000
UniProt: A0ABY7YUH2
LinkDB
Position
2438663..2440066
AA seq 467 aa
MTEASGPTETKMVADRLLMRRIAILASLALVFVAGCAALLLAQGVDRQLKDVQHTFDMRT
AARDISIALVDAESGQLGYVLTQDESYLLPYEKTVHTIDERLLALREMATGDAEQSARVD
RVAKAVQGKIAEMASTVALVANSHEALATSIVKGGGGARLMEDLRNTLNAFIAEEDKNLL
MRNSAIAGTRLWITVAILAALVGAVALTYVLFNRTERQVSALTRSQNELNSQREALALRV
LERTAELEESQAHAQRERERVETLLKDTNHRIGNSLATVSSLLGLQMMRSTSDEVKNALE
AARLRVHAIASSHRRLRLGDDLETTRADEFLHAVLDDLESTHEGTDPVRFVQDFEDISIS
SRDATTLGIILGELVTNALKHAFPEGRKGTISVRLFRDEAKIATLEVSDDGMGPSEKTNL
DDGGLGSVIVRQLTQQFGGKPAYEKNELGGLRVRVPLPKIAAEAPTV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgactgaggcctccggccctaccgaaacaaaaatggttgccgaccggctgctgatgcgg
cggattgccattctggcaagtctggcgctggtatttgttgcgggctgtgcagcgctgctg
ttggcgcaaggcgtcgaccgacagctcaaggatgtgcagcacacattcgacatgcgcaca
gcggcgcgcgacatttccattgcactggtggacgcggaaagcggccagttggggtacgtg
ctgacgcaggacgaatcctatttgctgccatacgaaaagaccgttcacaccattgatgag
cgattgctggcgttgcgggagatggcaacgggtgacgcggaacagagcgcccgcgtggat
agggttgccaaggcggttcagggcaaaatagccgaaatggcctcaacggtggctttggtg
gccaatagtcatgaggcgctggccacatcgatcgtcaagggtggcggcggtgcgcggctg
atggaggatttgcgcaatacgctcaatgccttcattgctgaggaggacaagaatcttctg
atgcgtaacagtgcgatagcggggacgcgcctatggatcacggttgcgattctggcggca
ttggtgggggcggtggcgctgacctacgtgttgttcaaccggaccgagcgacaggtttcg
gcgctgacgcgcagccagaacgaactcaacagccaacgtgaagcgctcgctctgcgggtg
ttggagcgcaccgctgaacttgaagaatcccaggcccatgcgcaacgtgagcgcgaacgg
gtggaaactcttttgaaggacaccaaccaccggatcggcaattcgttggccactgtttcc
tcgcttttgggcctgcagatgatgcgaagcacatccgacgaggtcaagaatgcactggag
gcggcgcgattgcgcgtgcatgccattgcctcgtcgcaccgccggttgcggctgggcgac
gatctggagacgacccgggcggacgagttcttgcatgcggtcctggacgatctggaatcc
acgcatgaggggacggacccagtcaggttcgtgcaagattttgaagatatttcgatcagt
tcgcgcgacgccacaacgctgggcatcatattaggcgaattggtgaccaatgcgcttaag
catgcctttcccgagggtcgcaagggcacgatcagcgtgaggctatttcgagacgaggca
aaaattgccacgctcgaggtgagtgacgacgggatggggcccagcgaaaagaccaatctg
gatgatggcggcctcggctcggtcattgttcgtcaattgacccaacaatttggcggcaag
ccggcatatgagaaaaacgagttgggcggattgcgggtcagggtgccacttcccaaaatt
gcggccgaggcacccacagtttag

DBGET integrated database retrieval system