Dehalobacter restrictus: DEHRE_13380 Help Entry DEHRE_13380       CDS       T02996                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism drs  Dehalobacter restrictus Pathway drs01100   Metabolic pathways drs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:drs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DEHRE_13380    00074 Mycolic acid biosynthesis     DEHRE_13380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DEHRE_13380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AHF10935 UniProt:  A0ABN4BV39 LinkDB All DBs Position complement(2661130..2661360) Genome browser AA seq 76 aa AA seqDB search MPFDTICRIIASQIEIEPEKIQLSTKFQQDLGIDSLSIFEIVMELEDVYRIEIPTEDLEE LISVADLVDYMSKRTN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccttttgacacgatctgcaggattattgcctcccagattgagattgaaccggagaaa atacagctgtccaccaagttccagcaagacctcgggattgactctctaagcatttttgaa attgttatggagctggaagatgtatacaggattgaaattccgactgaagatcttgaagaa ttaatcagcgtagcagatctggttgactatatgagtaagcgaacgaattga

DBGET integrated database retrieval system