Desulfohalobium retbaense: Dret_1416 Help Entry Dret_1416         CDS       T00989                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism drt  Desulfohalobium retbaense Pathway drt01100   Metabolic pathways drt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:drt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dret_1416    00074 Mycolic acid biosynthesis     Dret_1416   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dret_1416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACV68703 UniProt:  C8X2Q6 LinkDB All DBs Position 1647203..1647433 Genome browser AA seq 76 aa AA seqDB search MAAFEKLQEIVAEQLGVSNDEVKPEASFVEDLGADSLDLTELIMAMEDEFGIEIDDEEAQ KLTTVKAALDYIEANS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctgcttttgaaaaacttcaggaaattgttgccgaacaactcggtgtctccaatgat gaggtcaaacccgaagcctcttttgtcgaggaccttggcgccgattccctggatctgacc gaattgatcatggccatggaagatgaattcggcattgaaattgatgacgaggaagcccag aagttgacgacggtgaaagccgctctggattacatcgaagccaacagctaa

DBGET integrated database retrieval system