Maridesulfovibrio salexigens: Desal_0537 Help Entry Desal_0537        CDS       T00969                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism dsa  Maridesulfovibrio salexigens Pathway dsa01100   Metabolic pathways dsa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Desal_0537    00074 Mycolic acid biosynthesis     Desal_0537   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Desal_0537 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACS78604 UniProt:  C6BXP6 LinkDB All DBs Position complement(585941..586195) Genome browser AA seq 84 aa AA seqDB search MTDEELIKRINSALAEEFELELDEMVPEAVFKDDLDLDSLDAVDMVIVLEQEFGIKIKKD EAFKAIRTLGDLHKFILSKKDEAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacagatgaagaactcataaaaagaatcaactctgcgcttgccgaagaattcgagctg gagcttgatgaaatggtccccgaagcagtcttcaaggatgaccttgatctcgacagcctt gatgctgtggatatggtcatcgttctggagcaggaattcgggatcaaaatcaagaaagac gaagccttcaaggctatccgtactctcggtgacctgcataagttcatcctgagcaaaaaa gacgaagccgcttaa

DBGET integrated database retrieval system