KEGG   Devosia salina: K1X15_14820
Entry
K1X15_14820       CDS       T07996                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
dsal  Devosia salina
Pathway
dsal02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsal00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K1X15_14820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsal02000]
    K1X15_14820
Transporters [BR:dsal02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    K1X15_14820
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N ABC_ATPase AAA_22 AAA AAA_23 ORC-CDC6-like AAA_25 nSTAND3 Rad17 AAA_14 AAA_16 AAA_29 AAA_28 RsgA_GTPase NB-ARC PRK nSTAND1
Other DBs
NCBI-ProteinID: QYO75891
UniProt: A0ABX8WFY2
LinkDB
Position
3014804..3015787
AA seq 327 aa
MAAFLQVQNLVKTFGQTTVVKGVSFAFDKGEFISLLGPSGCGKTTILRMIAGFETPSSGS
IEVDSKDITHLKPNQRQLGMVFQAYALFPNLTVGDNIAFGLKVAGMGREERRARVDDMLR
LIGLPGYEKRYPYEMSGGQQQRVALARAIAPRPRLLLLDEPLSALDAKIRVSLREEIRSI
QRELGITTVFVTHDQEEALSISDRIVVMNAGRIEQMGSPYDIYNRPATRFAATFVGHLNT
LPASVFGPDRAIRPELISLHPRPDTDTTLSGTVSDIGFLGSVLRLRVEVDGTDISIDTFN
AQSGPPQRGERIALHLASRDVLTLGAA
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccgcctttctccaagtccagaacctggtcaagacctttgggcagaccaccgtggtc
aagggcgtcagttttgccttcgacaaaggcgagttcatctccctgctcggcccatccggc
tgtggcaagaccaccatcctgcggatgatcgccggcttcgagacaccgagcagcgggtcc
attgaggtcgatagcaaggacattacccacctcaagcccaatcagcgccagctcggcatg
gtgtttcaggcctacgcgcttttccccaatctcaccgtaggcgacaacattgcctttggc
ctcaaggtcgccggcatggggcgcgaggagcgccgggcccgcgtcgatgacatgctcagg
ctcatcggcctgcccggctacgaaaaacgctatccctatgaaatgagcggcgggcagcag
caacgcgtggccctggcgcgggccatcgctccgcggccccgcctgctgctgcttgacgag
ccgctttcggcgctcgacgccaagatccgcgtttccctgcgcgaggaaattcgctcgata
cagcgcgaactgggcatcaccaccgtcttcgtcacgcatgaccaggaagaggcgttgtcg
atctctgaccggatcgtggtgatgaatgctggccgtatcgagcagatgggcagcccatac
gacatctacaatcgcccggcgacccgctttgcagcgaccttcgtggggcacctcaacacc
ctgcccgcctcggtctttggccccgaccgcgcgatccggcccgagctgatctcgctccat
ccccgccccgacaccgacaccactttgagcgggacggtttcggacataggtttcctcggt
tccgttctgcggctgcgcgtcgaggtcgacggcaccgatatcagcatcgacaccttcaac
gcccagtccgggccaccgcagcggggtgaacgcatcgccctgcatctggcatcacgggac
gtgctgaccctcggcgccgcatag

DBGET integrated database retrieval system