Desulfovibrio subterraneus: LN040_01515 Help Entry LN040_01515       CDS       T08953                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dsb  Desulfovibrio subterraneus Pathway dsb00020   Citrate cycle (TCA cycle) dsb00720   Other carbon fixation pathways dsb01100   Metabolic pathways dsb01110   Biosynthesis of secondary metabolites dsb01120   Microbial metabolism in diverse environments dsb01200   Carbon metabolism dsb01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dsb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LN040_01515   09102 Energy metabolism    00720 Other carbon fixation pathways     LN040_01515 Enzymes [BR:dsb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LN040_01515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_21 Fer4_9 Fer4_4 Fer4_2 Fer4_6 Fer4_16 Fer4_8 Fer4_17 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  WBF69264 LinkDB All DBs Position 343458..343727 Genome browser AA seq 89 aa AA seqDB search MPKKKKGQTLVCVYPDWCKGCGICVAFCPGKVLEMSALGKAEPVRPEDCINCGFCELHCP DFAISIRPREDGATCPSFPSGPPTNGEAC NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgccaaagaaaaagaaagggcagacactggtgtgtgtgtacccggattggtgtaaaggg tgcggtatttgtgtcgcattctgtccgggaaaggtgctggaaatgagcgcattgggcaag gcggagcccgtgcgtccggaagactgcatcaattgtggcttctgtgaactgcactgtcca gattttgcaatctccatccggccacgggaggatggagcaacctgtccgtcgttcccttcc ggccctccaaccaacggtgaggcttgctga

DBGET integrated database retrieval system