Desulfovibrio subterraneus: LN040_17650 Help Entry LN040_17650       CDS       T08953                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsb  Desulfovibrio subterraneus Pathway dsb01100   Metabolic pathways dsb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LN040_17650 (acpP)    00074 Mycolic acid biosynthesis     LN040_17650 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LN040_17650 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WBF67507 LinkDB All DBs Position complement(4056578..4056808) Genome browser AA seq 76 aa AA seqDB search MSIEAKVKQIIIDQLGVSAEEVKPEASFVEDLGADSLDLTELIMAMEEEFGTEIDDDDAQ KMLKVQDAINYIASKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctatcgaagcaaaagttaagcagatcatcatcgaccagctcggcgtttctgccgaa gaagtaaagcccgaagcatctttcgttgaagatctgggcgcagactctctcgacctgacc gaactgatcatggccatggaagaagaattcggcaccgaaatcgatgacgacgatgcacag aagatgctgaaggtgcaggacgccatcaattacatcgcaagcaagcagtaa

DBGET integrated database retrieval system