Desulfolutivibrio sulfodismutans: GD606_11500 Help Entry GD606_11500       CDS       T06784                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsd  Desulfolutivibrio sulfodismutans Pathway dsd01100   Metabolic pathways dsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GD606_11500    00074 Mycolic acid biosynthesis     GD606_11500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GD606_11500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QLA14483 LinkDB All DBs Position complement(2504551..2504784) Genome browser AA seq 77 aa AA seqDB search MTATLDDLKRLIVRTGLSPQTADRLDPAVPLTRQGVDSIAHPLFILAVEERFGVHVSEEQ ALTLRTLDDFMAMLNMA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgactgcaacccttgatgacctgaagcggctgatcgtccgcacgggcctcagcccgcag accgccgaccggcttgatccggcagtgccgctgacgcgccagggcgtggactccatcgcc catcccctttttattctggccgttgaggaaaggttcggcgtgcatgtgagcgaggaacag gccttgacgctgcgcacgctggacgattttatggccatgctcaacatggcgtag

DBGET integrated database retrieval system