Drosophila sechellia: 116800526 Help Entry 116800526         CDS       T01064                                  Name (RefSeq) immune-induced peptide 3   KO K20695   immune-induced peptide 1/2/3 Organism dse  Drosophila sechellia Pathway dse04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dse00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     116800526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DIM MNHE Motif Other DBs NCBI-GeneID:  116800526 NCBI-ProteinID:  XP_032571858 LinkDB All DBs Position 2R:14480434..14480811 Genome browser AA seq 39 aa AA seqDB search MKFLSLAFVLGLLALANATPLTPGNVIINGDCRVCNVRA NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaaattcctatcactcgccttcgttctgggtctgctggctctggccaacgccactcca ctgactcctggcaatgtcatcatcaacggcgattgccgcgtctgcaatgtgagggcctaa

DBGET integrated database retrieval system