KEGG   Drosophila sechellia: 116802150
Entry
116802150         CDS       T01064                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dse  Drosophila sechellia
Pathway
dse00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    116802150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dse00199]
    116802150
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     116802150
Cytochrome P450 [BR:dse00199]
 Cytochrome P450, animal type
  CYP306 family
   116802150
SSDB
Motif
Pfam: p450 Med17 DUF4746 DNA_pol_phi Tra1_central RXT2_N
Other DBs
NCBI-GeneID: 116802150
NCBI-ProteinID: XP_032581365
LinkDB
Position
X:18824976..18827537
AA seq 574 aa
MSAGIVDIGHTGWMPSVQSLSVLLVPGAIVLVILYLCERQCNDIMGAPPPGPWGLPFLGY
LPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAAVVRDFFRRDVMTGRAPLFLT
HGIMGGFGIICAQDDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRFFD
TEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGV
VNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQR
QLEKEQRRQSKEADPDQEQSEADEDDEESDEEDTYEPECILEHFLTVRDTDSQLYCDDQL
RHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRA
CISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPE
RFLTPDGVYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHVELPPGTEVDMAG
ESGITLTPTPHRLRFTKLPAVEMRHAPDGAVVQD
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgtcggcgggcatcgtcgatattggccacaccggttggatgccctcggtgcagagcctg
agtgttctgctggttccgggtgcgatcgtcctggtgattctctacctgtgcgagcgccag
tgcaatgacatcatgggtgccccaccgccgggtccctggggcctgccctttctgggttac
ttgcctttcttggacgcccgtgcgccgcacaagtcactccaaaagctggccaagcggtat
ggcggcatcttcgaactgaaaatgggcagggtgccgaccgtagtcctctcggatgccgcc
gtggtgcgggatttctttcgccgcgatgtgatgactggccgtgctccactcttcctcacc
cacggcatcatgggtggattcggaatcatttgcgcccaggatgacatttggcgacatgcg
cgtcgcgagactatcgattggctgaaggcgttgggcatgacccgtcggccgggggaactg
cgcgcccggctggagcggcgcatagcccgcggagtcgacgagtgcgtccggtttttcgat
actgaggcgaagaagagctgtgcgtcggaagtgaatccgctgccggcgctccaccactct
ctgggcaacataatcaacgacctggtcttcgggatcacctacaagcgggacgaccccgac
tggctgtacctgcagcggctgcaggaggagggcgtcaagctgattggcgtgtccggggtg
gtcaactttctgccctggctgcgtcacctgcccgccaacgtgcgcaacatccgcttcctg
ctggagggcaaggccaagacgcacgccatctacgaccgtatagtggaggcatgtggccag
cggctgaaggagaagcagaaggtgtttaaggagctccaggagcagaagcggctgcaaaga
cagctggagaaggagcagcgcaggcaatcgaaggaagcggatccagaccaggagcagagt
gaagcggacgaggatgacgaggagagcgatgaggaggacacgtacgagccagagtgcatc
ctggagcacttcctcaccgttcgcgacacggactcgcagctctactgcgacgaccagctg
cgccatctgctggccgatctctttggagccggggtggacacctctctggccaccctgcgc
tggttcctgctctacttggcccgcgaacaacgctgccagcggcgcctgcatgagctcctc
ctgccgctgggtccgtctcccactttggaggaactggagccgctggcctacctaagggct
tgcatttccgagacgatgcgcatacgcagcgttgtcccgctgggcattccgcacggatgc
aaagagaacttcgtcgtgggcgattatttcatcaagggcggttcgatgatcgtttgctcg
gagtgggccatccacatggacccagtggccttcccggaaccggaggagttccgtccggag
cgcttcctgacccccgatggagtctaccaggcgccgccacagttcatcccattctcgtcc
ggctaccgaatgtgtcccggcgaagagatggctcgcatgattctcacgctcttcacgggt
cgcatcctcaggcgcttccacgtggaactgcctccgggcactgaggtggacatggcgggc
gagagcggcatcaccctgacccccactccgcacaggctgcgattcaccaagctgccggcg
gtggagatgcgtcatgcacccgacggagctgtggtgcaggactag

DBGET integrated database retrieval system