Drosophila sechellia: 6605102 Help Entry 6605102           CDS       T01064                                  Name (RefSeq) probable insulin-like peptide 2   KO K04526   insulin Organism dse  Drosophila sechellia Pathway dse04068   FoxO signaling pathway dse04081   Hormone signaling dse04140   Autophagy - animal dse04150   mTOR signaling pathway dse04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dse00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6605102    04150 mTOR signaling pathway     6605102   09133 Signaling molecules and interaction    04081 Hormone signaling     6605102  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6605102  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6605102  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dse04052]     6605102 Cytokines and neuropeptides [BR:dse04052]  Neuropeptides   Unclassified    6605102 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6605102 NCBI-ProteinID:  XP_002029943 UniProt:  B4HLB0 LinkDB All DBs Position 3L:9557961..9558731 Genome browser AA seq 137 aa AA seqDB search MSKPVSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSD LDPLNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLSSLAEVRRRTRQRQGIVERCCK KSCDMKALREYCSVVRN NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagcaagcctgtgtccttcatctcgatggtggctgtgattttgctggccagctccaca gtgaagttggcccaaggaacgctctgcagtgaaaagctcaacgaggtgctgagtatggtg tgcgaggagtataatcccgtgattccccacaagcgcgccatgcccggtgccgacagcgac ctggaccccctcaatcccctgcagtttgtccaggagttcgaggaggaggacaattcgatc tcggaaccgctgcgaagtgccctctttcctgggagctatctggggggcgtcctcagttcc ctggcggaagtccggaggcgaactcgccaacggcaaggaatcgtggagaggtgctgcaaa aagtcctgtgatatgaaggccctgcgggagtactgctccgtcgtcagaaattag

DBGET integrated database retrieval system