Drosophila sechellia: 6605103 Help Entry 6605103           CDS       T01064                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism dse  Drosophila sechellia Pathway dse04068   FoxO signaling pathway dse04081   Hormone signaling dse04140   Autophagy - animal dse04150   mTOR signaling pathway dse04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dse00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6605103    04150 mTOR signaling pathway     6605103   09133 Signaling molecules and interaction    04081 Hormone signaling     6605103  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6605103  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6605103  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dse04052]     6605103 Cytokines and neuropeptides [BR:dse04052]  Neuropeptides   Unclassified    6605103 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6605103 NCBI-ProteinID:  XP_002029944 UniProt:  B4HLB1 LinkDB All DBs Position 3L Genome browser AA seq 123 aa AA seqDB search MGIEMRCQGRRILLPSLLLLILMIGGVQATMKLCGRKLPETLSKLCVYGFNAMTKRTLDA VNFNLIDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCAAKPRT ITS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgggcatcgagatgaggtgtcagggcaggaggatcctgctacccagcctgctactgcta atcctcatgatcggcggtgtccaggccaccatgaagttgtgtggccgcaaactgcccgaa acgctctccaagctttgtgtgtatggcttcaacgcaatgaccaagagaactttggacgcc gtgaacttcaacctgatcgatggcttcgaagaccgttccctgctggaaagactgttgagt gatagttcggttcagatgctcaagactcgacgtcttcgggatggagtcttcgacgagtgt tgcctgaagtcgtgcaccatggatgaggtgctgaggtattgtgctgccaagcccagaacg ataacctcgtaa

DBGET integrated database retrieval system