Drosophila sechellia: 6607103 Help Entry 6607103           CDS       T01064                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism dse  Drosophila sechellia Pathway dse04013   MAPK signaling pathway - fly dse04068   FoxO signaling pathway dse04137   Mitophagy - animal dse04140   Autophagy - animal dse04150   mTOR signaling pathway dse04213   Longevity regulating pathway - multiple species dse04214   Apoptosis - fly dse04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:dse00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6607103    04068 FoxO signaling pathway     6607103    04150 mTOR signaling pathway     6607103  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6607103    04137 Mitophagy - animal     6607103   09143 Cell growth and death    04214 Apoptosis - fly     6607103  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     6607103   09149 Aging    04213 Longevity regulating pathway - multiple species     6607103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dse04131]     6607103   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dse04031]     6607103 Membrane trafficking [BR:dse04131]  Endocytosis   Macropinocytosis    Ras GTPases     6607103 GTP-binding proteins [BR:dse04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6607103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Aldo_ket_red AAA_25 Motif Other DBs NCBI-GeneID:  6607103 NCBI-ProteinID:  XP_002031891 UniProt:  B4HKC7 LinkDB All DBs Position 3R:18924552..18926904 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc atccagcttatccagaaccatttcgtggacgagtacgatcccacaatcgaggactcctac cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc caagaggagtactcggccatgcgggatcagtatatgcggaccggcgagggattcctgctg gtctttgccgtcaacagtgcgaagtccttcgaggatatcggcacctaccgtgagcagatc aagcgcgtgaaggacgccgaggaggtgcccatggtgctggttggcaacaaatgtgatctg gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgaaaaatgaacaagccg aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system