Drosophila sechellia: 6611146 Help Entry 6611146           CDS       T01064                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dse  Drosophila sechellia Pathway dse04013   MAPK signaling pathway - fly dse04145   Phagosome dse04148   Efferocytosis dse04310   Wnt signaling pathway dse04620   Toll-like receptor signaling pathway dse05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dse00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6611146    04310 Wnt signaling pathway     6611146  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6611146    04148 Efferocytosis     6611146  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6611146  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6611146  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dse04131]     6611146   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dse04147]     6611146    04031 GTP-binding proteins [BR:dse04031]     6611146 Membrane trafficking [BR:dse04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6611146  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6611146   Macropinocytosis    Ras GTPases     6611146  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6611146 Exosome [BR:dse04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6611146   Exosomal proteins of other body fluids (saliva and urine)    6611146   Exosomal proteins of colorectal cancer cells    6611146   Exosomal proteins of bladder cancer cells    6611146 GTP-binding proteins [BR:dse04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6611146 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6611146 NCBI-ProteinID:  XP_032574003 LinkDB All DBs Position 3L:complement(7291984..7294408) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLR DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRGPKRHKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgtgtggttgtgggcgacggagcggtgggaaagacctgcctgctg atcagctatacgaccaacgccttcccgggcgagtacatacccactgtgttcgacaactac tcggcgaatgtgatggtggatgccaagcccatcaatctgggcctctgggatacggctggt caggaggactacgatcgcctgaggccgctatcctatccgcaaacggatgtctttctcatc tgtttctcactggtgaatccggcatcgtttgagaacgtgcgggccaaatggtttcccgag gtgcgtcatcactgcccgagtgtgccaataatcctggtcggcaccaagctagatctgcgc gacgataagcagacgatcgagaagctgaaggacaagaagctgacaccgatcacctatccc cagggactggcgatggccaaggaaatagctgcggtcaagtatctggagtgctctgccctg acccaaaagggtctgaagacggtcttcgatgaggccatacgatccgtgctatgtcctgtc gttcgaggacccaagaggcataagtgcgctctgctctaa

DBGET integrated database retrieval system