Drosophila sechellia: 6611694 Help Entry 6611694           CDS       T01064                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism dse  Drosophila sechellia Pathway dse03030   DNA replication dse03082   ATP-dependent chromatin remodeling dse03410   Base excision repair dse03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dse00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     6611694    03410 Base excision repair     6611694    03420 Nucleotide excision repair     6611694   09126 Chromosome    03082 ATP-dependent chromatin remodeling     6611694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dse03032]     6611694    03036 Chromosome and associated proteins [BR:dse03036]     6611694    03400 DNA repair and recombination proteins [BR:dse03400]     6611694 Enzymes [BR:dse01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      6611694 DNA replication proteins [BR:dse03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     6611694 Chromosome and associated proteins [BR:dse03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     6611694 DNA repair and recombination proteins [BR:dse03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       6611694 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Pim MobB DUF6488 Motif Other DBs NCBI-GeneID:  6611694 NCBI-ProteinID:  XP_002036228 UniProt:  B4HYM1 LinkDB All DBs Position 2L:8280655..8281241 Genome browser AA seq 129 aa AA seqDB search MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQN HKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSSTVENANASST AAAAEEAAE NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggtcgagcgcatcgaggatcttaacctaccgaatgccgtgattggccggctcatcaag gaagcactgccggagtcagctagtgtcagcaaggaagcgagagcagcgatcgcccgagcg gcatctgtgtttgccatctttgtgacatcctcgtcgacggcgttggcccacaagcagaac cacaagaccatcacggccaaggacattctacagaccctcaccgagctagacttcgagagc tttgtgccctccctgacgcaggatcttgaggtctatcgaaaagtggtcaaggagaaaaag gagagcaaggccagcaagaaggactccagcactgtcgaaaatgccaacgccagttccaca gccgcagcagcagaggaagccgccgagtga

DBGET integrated database retrieval system