Drosophila sechellia: 6616619 Help Entry 6616619           CDS       T01064                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism dse  Drosophila sechellia Pathway dse04145   Phagocytosis dse04814   Motor proteins Brite KEGG Orthology (KO) [BR:dse00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     6616619   09142 Cell motility    04814 Motor proteins     6616619  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dse03037]     6616619    04812 Cytoskeleton proteins [BR:dse04812]     6616619 Cilium and associated proteins [BR:dse03037]  Motile cilia and associated proteins   Dynein arm    6616619 Cytoskeleton proteins [BR:dse04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      6616619 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 MCEL_GT_NTPase DUF6547 Fascin Motif Other DBs NCBI-GeneID:  6616619 NCBI-ProteinID:  XP_002040977 UniProt:  B4IB67 LinkDB All DBs Position 3R Genome browser AA seq 111 aa AA seqDB search MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYK YIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgactcacgcgaagaaagccagttcattgtggacgacgtgagcaagacgattaaa gaggccatcgagacgaccatcggcggtaacgcctaccagcacgacaaggtgaacaactgg accggccaggtggtggagaactgcctgacggtgctcaccaaggagcagaagccctacaag tacattgtgaccgccatgatcatgcaaaagaacggtgctggactccacaccgccagctcc tgctactggaacaacgacaccgacggatcctgcacagtgcgctgggagaacaagaccatg tactgcatcgtttcggtcttcggactggctgtctag

DBGET integrated database retrieval system