Drosophila sechellia: 6619251 Help Entry 6619251           CDS       T01064                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dse  Drosophila sechellia Pathway dse04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6619251  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dse04121]     6619251    03400 DNA repair and recombination proteins [BR:dse03400]     6619251 Ubiquitin system [BR:dse04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6619251    Cul5 complex      6619251 DNA repair and recombination proteins [BR:dse03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6619251 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  6619251 NCBI-ProteinID:  XP_002043469 UniProt:  B4IIA9 LinkDB All DBs Position 3R Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQD YGVTVSTAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttccttatgatcaggcggcaaaagaccaccatcttcacggacgccaaggag aacacaacggtggccgagctgaagcgaatgattgagggcatactgaaggtgcagcccgtg gaccagcggttatacaatcaggacaacgatgtcatggaggacgacagcacgttgcaggac tacggcgtgacggtgtccacggccaaggcgcaggctccggcgcagctgggcttgacattc aggaacgaggtgggcgactttgagacactggacatgacaccctactcggcaccaccagac ttacccgaagtcatgaaaaaccaagaggcctccaacggacaggagcaggtggcataa

DBGET integrated database retrieval system