Desulfocapsa sulfexigens: UWK_01561 Help Entry UWK_01561         CDS       T02473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsf  Desulfocapsa sulfexigens Pathway dsf01100   Metabolic pathways dsf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UWK_01561    00074 Mycolic acid biosynthesis     UWK_01561   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UWK_01561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGF78119 UniProt:  M1NEI9 LinkDB All DBs Position complement(1747476..1747745) Genome browser AA seq 89 aa AA seqDB search MKGSVDNTLKLRLKTMIFTECDIEDITPDELNDDVMIFSDASGLGLDSLDALQISMGLQN QFGTRLVDSKEFRRRVTTINALADYIQPE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaagggtcagttgacaatacattaaaactacgcctgaaaaccatgatattcacagag tgtgatattgaggacataacaccggatgaattgaatgatgatgttatgattttttccgac gccagtggactcggcctggattcactggacgccctgcagatctccatggggctgcagaat cagtttggaacacgacttgtggacagcaaggaatttcgccgccgtgtcaccaccatcaac gctctggccgattatatccagccagagtaa

DBGET integrated database retrieval system