Desulfocapsa sulfexigens: UWK_02570 Help Entry UWK_02570         CDS       T02473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsf  Desulfocapsa sulfexigens Pathway dsf01100   Metabolic pathways dsf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UWK_02570    00074 Mycolic acid biosynthesis     UWK_02570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UWK_02570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  AGF79106 UniProt:  M1PRX6 LinkDB All DBs Position 2865124..2865354 Genome browser AA seq 76 aa AA seqDB search MAIEQQMVDIIVEQLSVDKDKVVPGASFVDDLGADSLDLVELIMAMEEEFDVEIPDEEAE KIATVQNAIDFVNNLK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaattgaacaacagatggttgatattatcgttgagcagttgagtgttgataaagat aaagtggttcccggtgcatcatttgttgatgaccttggggccgattccctcgatcttgtt gaactgattatggcaatggaagaagaatttgacgtcgaaattcccgacgaggaagccgaa aaaatcgctactgtccagaatgctattgattttgtaaacaacttgaaataa

DBGET integrated database retrieval system