Desulfocapsa sulfexigens: UWK_02974 Help Entry UWK_02974         CDS       T02473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsf  Desulfocapsa sulfexigens Pathway dsf01100   Metabolic pathways dsf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UWK_02974    00074 Mycolic acid biosynthesis     UWK_02974   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UWK_02974 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGF79503 UniProt:  M1P7R6 LinkDB All DBs Position 3299858..3300109 Genome browser AA seq 83 aa AA seqDB search MTRDAIKNLILEIIEDIDEDADFEALQPDKPLRDQLDLDSMDFLDIVMELRKRHKLQIPE EDYPELATLDSCVNYLEPLLADA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacacgtgacgcgattaagaaccttattcttgaaataattgaagatattgacgaagat gctgatttcgaagcacttcagccagacaaacctctgcgagaccagctcgatctcgattca atggattttctagatattgttatggaattacgcaaacgtcacaaactgcagatacctgaa gaggattatccagaacttgcaacccttgactcatgtgttaactacctggaaccccttctt gccgacgcatag

DBGET integrated database retrieval system