KEGG   Drosophila simulans: Dsimw501_GD10798
Entry
Dsimw501_GD10798  CDS       T01065                                 
Symbol
Dsim_GD10798
Name
(GenBank) uncharacterized protein, isoform A
  KO
K09884  aquaporin rerated protein, invertebrate
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsi02000]
    Dsimw501_GD10798 (Dsim_GD10798)
Transporters [BR:dsi02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    Dsimw501_GD10798 (Dsim_GD10798)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-ProteinID: KMY93005
UniProt: B4QBL5
LinkDB
Position
2R
AA seq 264 aa
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFKALAFGLAIF
MAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYY
NGLGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHL
GTIRYTGASMNPARTVGTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNE
ASEKYRTHADEREMRKLEGARDYA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgggaaaattcgaatactcactgggtctcaatgagctcaaatccaaggagctgcgattg
tggcaggccctgattggagagttcctgggcaatctgatcctcaatttctttgcctgcggc
gcatgcacccaaattgaggatggcaccttcaaagccttggcttttggcctggccatcttt
atggccatcacgattgtgggtcacttgagtggtggtcatgtgaatcctgccgttaccgct
ggaatgttggtcgcaggacgaattagcttgatcagagcctttttctatgtggttttccag
tgcctgggtgccattgccggaactgcagcggttaagattctcatcgatcaggactattat
aatggcctaggtcacacctcgctggcgcccaatatcaccgagctgcagggcctgggaatc
gagttcttcctgggactcctgctggtgctcgtcgtctttggggcctgtgatccccacaag
cccgattcccgctatacggcgcccctggccatcggaatggcggtgaccctgggtcacttg
ggcaccattcggtacaccggggccagcatgaatcccgcccgcactgtgggcaccgccttt
gccaccgacatctgggcgtcgcattgggtatactgggtgggtcctgtgctggggggcgtg
gctgccgccctgctctacacccaggtcctggaggcgaagcccgtgccgaaggtgaacgag
gcatccgagaagtaccgaacgcacgccgatgaacgcgagatgcgcaaactggagggagcc
cgcgactacgcctag

DBGET integrated database retrieval system