Drosophila simulans: Dsimw501_GD23096 Help Entry Dsimw501_GD23096  CDS       T01065                                  Symbol Dsim_GD23096 Name (GenBank) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism dsi  Drosophila simulans Pathway dsi04145   Phagocytosis dsi04517   IgSF CAM signaling dsi04814   Motor proteins Brite KEGG Orthology (KO) [BR:dsi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     Dsimw501_GD23096 (Dsim_GD23096)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     Dsimw501_GD23096 (Dsim_GD23096)   09142 Cell motility    04814 Motor proteins     Dsimw501_GD23096 (Dsim_GD23096)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dsi03037]     Dsimw501_GD23096 (Dsim_GD23096)    04812 Cytoskeleton proteins [BR:dsi04812]     Dsimw501_GD23096 (Dsim_GD23096) Cilium and associated proteins [BR:dsi03037]  Motile cilia and associated proteins   Dynein arm    Dsimw501_GD23096 (Dsim_GD23096) Cytoskeleton proteins [BR:dsi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dsimw501_GD23096 (Dsim_GD23096) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SpoIIIAH Motif Other DBs NCBI-ProteinID:  KMY87464 UniProt:  B4Q740 LinkDB All DBs Position 2L Genome browser AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGR NFGSYVTHETRHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcggatcgcaaggcggtgatcaagaacgctgacatgagcgaggagatgcagcaggac gctgtggactgcgccacccaggctctggagaagtacaacatcgagaaggacatcgccgcc ttcatcaagaaggagttcgacaagaagtacaaccccacctggcactgcatcgtgggccgc aacttcggctcctatgtgacccacgagacgcgtcacttcatctatttctacctgggccag gtggccattctgctcttcaagagcggttaa

DBGET integrated database retrieval system