Dickeya solani IPO 2222: A4U42_00985 Help Entry A4U42_00985       CDS       T04410                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dso  Dickeya solani IPO 2222 Pathway dso01100   Metabolic pathways dso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U42_00985    00074 Mycolic acid biosynthesis     A4U42_00985   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U42_00985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ANE74034 LinkDB All DBs Position complement(238629..238865) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKPEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagctgggcgttaagccg gaagaagtcgtgaacaatgcctctttcgttgatgacctgggcgctgattctcttgacact gttgagctggtaatggcattggaagaagaattcgataccgagatcccagacgaagaagct gagaaaatcacgactgttcaggcagccatcgattttattcaggctaaccagcagtaa

DBGET integrated database retrieval system