Dickeya solani IPO 2222: A4U42_01555 Help Entry A4U42_01555       CDS       T04410                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dso  Dickeya solani IPO 2222 Pathway dso01100   Metabolic pathways dso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U42_01555    00074 Mycolic acid biosynthesis     A4U42_01555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U42_01555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANE74137 LinkDB All DBs Position complement(371088..371357) Genome browser AA seq 89 aa AA seqDB search MDAQKDILSVVLDIINGIKNTGFTPDVVDLDSFIGGELGVDSIEMLESWYEIEKRLHIKV NDGDKRGIYTLGDLVGTIEAHLPAEEIKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggacgctcagaaagacattctctccgttgttctcgacattattaacggcatcaaaaat accgggtttacccctgatgtcgtggacctggattcatttatcggcggtgagctgggtgtg gattcgatcgagatgcttgagtcctggtacgagattgagaagcggctccacatcaaggta aacgacggtgacaagcgcggtatttacacgctcggggatctggtcggcaccattgaagcc catctaccggctgaagagatcaagtcctga

DBGET integrated database retrieval system