Dickeya solani IPO 2222: A4U42_08885 Help Entry A4U42_08885       CDS       T04410                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dso  Dickeya solani IPO 2222 Pathway dso01100   Metabolic pathways dso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U42_08885    00074 Mycolic acid biosynthesis     A4U42_08885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U42_08885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANE75437 LinkDB All DBs Position 2111316..2111582 Genome browser AA seq 88 aa AA seqDB search MEDLFLEIKQMIIDALNLEEVSVDEIETEAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEMRQHFFSVATLASFIMSQRQASA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaagatcttttccttgaaatcaaacagatgattatcgatgccctgaaccttgaggag gtgagcgtcgatgaaatcgagactgaggctcccttgtttggcgaagggttggggctggat tcgatcgatgcgcttgagctcggtctggcggtgaaaaaccgctatggtgtggtgctttcc gctgaaagcgaggaaatgcggcagcatttcttttccgtcgcgacgctggcgtcattcatt atgtctcagcgtcaggccagcgcctga

DBGET integrated database retrieval system