Dickeya solani IPO 2222: A4U42_14550 Help Entry A4U42_14550       CDS       T04410                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism dso  Dickeya solani IPO 2222 Brite KEGG Orthology (KO) [BR:dso00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dso03032]     A4U42_14550    03036 Chromosome and associated proteins [BR:dso03036]     A4U42_14550    03400 DNA repair and recombination proteins [BR:dso03400]     A4U42_14550 DNA replication proteins [BR:dso03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A4U42_14550 Chromosome and associated proteins [BR:dso03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A4U42_14550 DNA repair and recombination proteins [BR:dso03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A4U42_14550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ANE76445 LinkDB All DBs Position 3368996..3369268 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKAGDDVALVGFGTFSVRERAARTG RNPQTGKEISIPAAKVPGFRAGKALKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcacaattgatcgacaaaattgccgcagatgctgatatttccaaagcggca gcagggcgtgtgttggatgcaattattgggtctgttactgaatctctgaaagcaggggat gacgttgctttagtcggttttggtacgttctccgtgcgtgagcgtgcagcgcgcactggt cgtaacccgcaaaccgggaaagaaatcagtattccggccgctaaagtgccgggtttccgt gctggcaaggcactgaaagactcagtgaattga

DBGET integrated database retrieval system