Dickeya solani IPO 2222: A4U42_15025 Help Entry A4U42_15025       CDS       T04410                                  Name (GenBank) prohead protease   KO K03425   sec-independent protein translocase protein TatE Organism dso  Dickeya solani IPO 2222 Pathway dso03060   Protein export dso03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dso00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A4U42_15025  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A4U42_15025  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dso02044]     A4U42_15025 Secretion system [BR:dso02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A4U42_15025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANE76534 LinkDB All DBs Position 3482024..3482233 Genome browser AA seq 69 aa AA seqDB search MEGISIAKLLVIGALIVLLFGTNKLRSLGSDLGAAIKGFKKSMSDEQPAAKSSAQDEHPA AISENRPKE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaggtatcagtattgccaagctcttagtgattggcgccttgattgttctgctgttc gggaccaataaactgcgcagtctgggcagcgatctgggtgccgctatcaaaggcttcaag aaatccatgagtgatgagcagccagcggccaaatcttccgctcaggatgaacatccagcc gccatcagcgaaaatcgtcctaaagaataa

DBGET integrated database retrieval system