Entry |
|
Symbol |
Rhoa
|
Name |
(RefSeq) transforming protein RhoA
|
KO |
K04513 | Ras homolog gene family, member A |
|
Organism |
dsp Dipodomys spectabilis (banner-tailed kangaroo rat)
|
Pathway |
dsp04072 | Phospholipase D signaling pathway |
dsp04270 | Vascular smooth muscle contraction |
dsp04621 | NOD-like receptor signaling pathway |
dsp04625 | C-type lectin receptor signaling pathway |
dsp04660 | T cell receptor signaling pathway |
dsp04670 | Leukocyte transendothelial migration |
dsp04810 | Regulation of actin cytoskeleton |
dsp04928 | Parathyroid hormone synthesis, secretion and action |
dsp05100 | Bacterial invasion of epithelial cells |
dsp05163 | Human cytomegalovirus infection |
dsp05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:dsp00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
122095683 (Rhoa)
04015 Rap1 signaling pathway
122095683 (Rhoa)
04310 Wnt signaling pathway
122095683 (Rhoa)
04350 TGF-beta signaling pathway
122095683 (Rhoa)
04072 Phospholipase D signaling pathway
122095683 (Rhoa)
04071 Sphingolipid signaling pathway
122095683 (Rhoa)
04024 cAMP signaling pathway
122095683 (Rhoa)
04022 cGMP-PKG signaling pathway
122095683 (Rhoa)
04150 mTOR signaling pathway
122095683 (Rhoa)
09133 Signaling molecules and interaction
04081 Hormone signaling
122095683 (Rhoa)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
122095683 (Rhoa)
09144 Cellular community - eukaryotes
04510 Focal adhesion
122095683 (Rhoa)
04520 Adherens junction
122095683 (Rhoa)
04530 Tight junction
122095683 (Rhoa)
09142 Cell motility
04810 Regulation of actin cytoskeleton
122095683 (Rhoa)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
122095683 (Rhoa)
04621 NOD-like receptor signaling pathway
122095683 (Rhoa)
04625 C-type lectin receptor signaling pathway
122095683 (Rhoa)
04660 T cell receptor signaling pathway
122095683 (Rhoa)
04670 Leukocyte transendothelial migration
122095683 (Rhoa)
04062 Chemokine signaling pathway
122095683 (Rhoa)
09152 Endocrine system
04921 Oxytocin signaling pathway
122095683 (Rhoa)
04928 Parathyroid hormone synthesis, secretion and action
122095683 (Rhoa)
09153 Circulatory system
04270 Vascular smooth muscle contraction
122095683 (Rhoa)
09154 Digestive system
04972 Pancreatic secretion
122095683 (Rhoa)
09156 Nervous system
04722 Neurotrophin signaling pathway
122095683 (Rhoa)
09158 Development and regeneration
04360 Axon guidance
122095683 (Rhoa)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
122095683 (Rhoa)
05206 MicroRNAs in cancer
122095683 (Rhoa)
05205 Proteoglycans in cancer
122095683 (Rhoa)
05203 Viral carcinogenesis
122095683 (Rhoa)
09162 Cancer: specific types
05210 Colorectal cancer
122095683 (Rhoa)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
122095683 (Rhoa)
09171 Infectious disease: bacterial
05132 Salmonella infection
122095683 (Rhoa)
05135 Yersinia infection
122095683 (Rhoa)
05133 Pertussis
122095683 (Rhoa)
05152 Tuberculosis
122095683 (Rhoa)
05100 Bacterial invasion of epithelial cells
122095683 (Rhoa)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
122095683 (Rhoa)
05418 Fluid shear stress and atherosclerosis
122095683 (Rhoa)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:dsp04131]
122095683 (Rhoa)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:dsp04147]
122095683 (Rhoa)
04031 GTP-binding proteins [BR:dsp04031]
122095683 (Rhoa)
Membrane trafficking [BR:dsp04131]
Endocytosis
Lipid raft mediated endocytosis
RhoA-dependent endocytosis
122095683 (Rhoa)
Exosome [BR:dsp04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
122095683 (Rhoa)
Exosomal proteins of other body fluids (saliva and urine)
122095683 (Rhoa)
Exosomal proteins of colorectal cancer cells
122095683 (Rhoa)
Exosomal proteins of bladder cancer cells
122095683 (Rhoa)
GTP-binding proteins [BR:dsp04031]
Small (monomeric) G-proteins
Rho Family
RhoA/B/C [OT]
122095683 (Rhoa)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL |
NT seq |
582 nt +upstreamnt +downstreamnt
atggctgccatccgaaagaaacttgtgattgtcggtgatggagcttgtggcaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccactgtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagaattggctttgtgggacaca
gctgggcaggaagattatgatcgcctgagacccctctcctacccagacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagttaagcatttctgtcccaacgtgcccattatcctggttggaaacaagaaggat
cttcggaatgatgagcacacaaggcgggagttagctaagatgaagcaggagccagttaaa
ccagaagagggcagagatatggccaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagacggagtgagagaggtttttgaaatggccacaagagccgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga |