KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122095844
Entry
122095844         CDS       T07891                                 
Symbol
Mapk1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp01521  EGFR tyrosine kinase inhibitor resistance
dsp01522  Endocrine resistance
dsp01524  Platinum drug resistance
dsp04010  MAPK signaling pathway
dsp04012  ErbB signaling pathway
dsp04014  Ras signaling pathway
dsp04015  Rap1 signaling pathway
dsp04022  cGMP-PKG signaling pathway
dsp04024  cAMP signaling pathway
dsp04062  Chemokine signaling pathway
dsp04066  HIF-1 signaling pathway
dsp04068  FoxO signaling pathway
dsp04071  Sphingolipid signaling pathway
dsp04072  Phospholipase D signaling pathway
dsp04114  Oocyte meiosis
dsp04140  Autophagy - animal
dsp04148  Efferocytosis
dsp04150  mTOR signaling pathway
dsp04151  PI3K-Akt signaling pathway
dsp04210  Apoptosis
dsp04218  Cellular senescence
dsp04261  Adrenergic signaling in cardiomyocytes
dsp04270  Vascular smooth muscle contraction
dsp04350  TGF-beta signaling pathway
dsp04360  Axon guidance
dsp04370  VEGF signaling pathway
dsp04371  Apelin signaling pathway
dsp04380  Osteoclast differentiation
dsp04510  Focal adhesion
dsp04517  IgSF CAM signaling
dsp04520  Adherens junction
dsp04540  Gap junction
dsp04550  Signaling pathways regulating pluripotency of stem cells
dsp04611  Platelet activation
dsp04613  Neutrophil extracellular trap formation
dsp04620  Toll-like receptor signaling pathway
dsp04621  NOD-like receptor signaling pathway
dsp04625  C-type lectin receptor signaling pathway
dsp04650  Natural killer cell mediated cytotoxicity
dsp04657  IL-17 signaling pathway
dsp04658  Th1 and Th2 cell differentiation
dsp04659  Th17 cell differentiation
dsp04660  T cell receptor signaling pathway
dsp04662  B cell receptor signaling pathway
dsp04664  Fc epsilon RI signaling pathway
dsp04666  Fc gamma R-mediated phagocytosis
dsp04668  TNF signaling pathway
dsp04713  Circadian entrainment
dsp04720  Long-term potentiation
dsp04722  Neurotrophin signaling pathway
dsp04723  Retrograde endocannabinoid signaling
dsp04724  Glutamatergic synapse
dsp04725  Cholinergic synapse
dsp04726  Serotonergic synapse
dsp04730  Long-term depression
dsp04810  Regulation of actin cytoskeleton
dsp04910  Insulin signaling pathway
dsp04912  GnRH signaling pathway
dsp04914  Progesterone-mediated oocyte maturation
dsp04915  Estrogen signaling pathway
dsp04916  Melanogenesis
dsp04917  Prolactin signaling pathway
dsp04919  Thyroid hormone signaling pathway
dsp04921  Oxytocin signaling pathway
dsp04926  Relaxin signaling pathway
dsp04928  Parathyroid hormone synthesis, secretion and action
dsp04929  GnRH secretion
dsp04930  Type II diabetes mellitus
dsp04933  AGE-RAGE signaling pathway in diabetic complications
dsp04934  Cushing syndrome
dsp04935  Growth hormone synthesis, secretion and action
dsp04960  Aldosterone-regulated sodium reabsorption
dsp05010  Alzheimer disease
dsp05020  Prion disease
dsp05022  Pathways of neurodegeneration - multiple diseases
dsp05034  Alcoholism
dsp05132  Salmonella infection
dsp05133  Pertussis
dsp05135  Yersinia infection
dsp05140  Leishmaniasis
dsp05142  Chagas disease
dsp05145  Toxoplasmosis
dsp05152  Tuberculosis
dsp05160  Hepatitis C
dsp05161  Hepatitis B
dsp05163  Human cytomegalovirus infection
dsp05164  Influenza A
dsp05165  Human papillomavirus infection
dsp05166  Human T-cell leukemia virus 1 infection
dsp05167  Kaposi sarcoma-associated herpesvirus infection
dsp05170  Human immunodeficiency virus 1 infection
dsp05171  Coronavirus disease - COVID-19
dsp05200  Pathways in cancer
dsp05203  Viral carcinogenesis
dsp05205  Proteoglycans in cancer
dsp05206  MicroRNAs in cancer
dsp05207  Chemical carcinogenesis - receptor activation
dsp05208  Chemical carcinogenesis - reactive oxygen species
dsp05210  Colorectal cancer
dsp05211  Renal cell carcinoma
dsp05212  Pancreatic cancer
dsp05213  Endometrial cancer
dsp05214  Glioma
dsp05215  Prostate cancer
dsp05216  Thyroid cancer
dsp05218  Melanoma
dsp05219  Bladder cancer
dsp05220  Chronic myeloid leukemia
dsp05221  Acute myeloid leukemia
dsp05223  Non-small cell lung cancer
dsp05224  Breast cancer
dsp05225  Hepatocellular carcinoma
dsp05226  Gastric cancer
dsp05230  Central carbon metabolism in cancer
dsp05231  Choline metabolism in cancer
dsp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dsp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122095844 (Mapk1)
   04012 ErbB signaling pathway
    122095844 (Mapk1)
   04014 Ras signaling pathway
    122095844 (Mapk1)
   04015 Rap1 signaling pathway
    122095844 (Mapk1)
   04350 TGF-beta signaling pathway
    122095844 (Mapk1)
   04370 VEGF signaling pathway
    122095844 (Mapk1)
   04371 Apelin signaling pathway
    122095844 (Mapk1)
   04668 TNF signaling pathway
    122095844 (Mapk1)
   04066 HIF-1 signaling pathway
    122095844 (Mapk1)
   04068 FoxO signaling pathway
    122095844 (Mapk1)
   04072 Phospholipase D signaling pathway
    122095844 (Mapk1)
   04071 Sphingolipid signaling pathway
    122095844 (Mapk1)
   04024 cAMP signaling pathway
    122095844 (Mapk1)
   04022 cGMP-PKG signaling pathway
    122095844 (Mapk1)
   04151 PI3K-Akt signaling pathway
    122095844 (Mapk1)
   04150 mTOR signaling pathway
    122095844 (Mapk1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122095844 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122095844 (Mapk1)
   04148 Efferocytosis
    122095844 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    122095844 (Mapk1)
   04210 Apoptosis
    122095844 (Mapk1)
   04218 Cellular senescence
    122095844 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122095844 (Mapk1)
   04520 Adherens junction
    122095844 (Mapk1)
   04540 Gap junction
    122095844 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    122095844 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122095844 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122095844 (Mapk1)
   04613 Neutrophil extracellular trap formation
    122095844 (Mapk1)
   04620 Toll-like receptor signaling pathway
    122095844 (Mapk1)
   04621 NOD-like receptor signaling pathway
    122095844 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    122095844 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    122095844 (Mapk1)
   04660 T cell receptor signaling pathway
    122095844 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    122095844 (Mapk1)
   04659 Th17 cell differentiation
    122095844 (Mapk1)
   04657 IL-17 signaling pathway
    122095844 (Mapk1)
   04662 B cell receptor signaling pathway
    122095844 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    122095844 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    122095844 (Mapk1)
   04062 Chemokine signaling pathway
    122095844 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122095844 (Mapk1)
   04929 GnRH secretion
    122095844 (Mapk1)
   04912 GnRH signaling pathway
    122095844 (Mapk1)
   04915 Estrogen signaling pathway
    122095844 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    122095844 (Mapk1)
   04917 Prolactin signaling pathway
    122095844 (Mapk1)
   04921 Oxytocin signaling pathway
    122095844 (Mapk1)
   04926 Relaxin signaling pathway
    122095844 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    122095844 (Mapk1)
   04919 Thyroid hormone signaling pathway
    122095844 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    122095844 (Mapk1)
   04916 Melanogenesis
    122095844 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122095844 (Mapk1)
   04270 Vascular smooth muscle contraction
    122095844 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122095844 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    122095844 (Mapk1)
   04725 Cholinergic synapse
    122095844 (Mapk1)
   04726 Serotonergic synapse
    122095844 (Mapk1)
   04720 Long-term potentiation
    122095844 (Mapk1)
   04730 Long-term depression
    122095844 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    122095844 (Mapk1)
   04722 Neurotrophin signaling pathway
    122095844 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    122095844 (Mapk1)
   04380 Osteoclast differentiation
    122095844 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    122095844 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122095844 (Mapk1)
   05206 MicroRNAs in cancer
    122095844 (Mapk1)
   05205 Proteoglycans in cancer
    122095844 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    122095844 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    122095844 (Mapk1)
   05203 Viral carcinogenesis
    122095844 (Mapk1)
   05230 Central carbon metabolism in cancer
    122095844 (Mapk1)
   05231 Choline metabolism in cancer
    122095844 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122095844 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122095844 (Mapk1)
   05212 Pancreatic cancer
    122095844 (Mapk1)
   05225 Hepatocellular carcinoma
    122095844 (Mapk1)
   05226 Gastric cancer
    122095844 (Mapk1)
   05214 Glioma
    122095844 (Mapk1)
   05216 Thyroid cancer
    122095844 (Mapk1)
   05221 Acute myeloid leukemia
    122095844 (Mapk1)
   05220 Chronic myeloid leukemia
    122095844 (Mapk1)
   05218 Melanoma
    122095844 (Mapk1)
   05211 Renal cell carcinoma
    122095844 (Mapk1)
   05219 Bladder cancer
    122095844 (Mapk1)
   05215 Prostate cancer
    122095844 (Mapk1)
   05213 Endometrial cancer
    122095844 (Mapk1)
   05224 Breast cancer
    122095844 (Mapk1)
   05223 Non-small cell lung cancer
    122095844 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122095844 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    122095844 (Mapk1)
   05161 Hepatitis B
    122095844 (Mapk1)
   05160 Hepatitis C
    122095844 (Mapk1)
   05171 Coronavirus disease - COVID-19
    122095844 (Mapk1)
   05164 Influenza A
    122095844 (Mapk1)
   05163 Human cytomegalovirus infection
    122095844 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122095844 (Mapk1)
   05165 Human papillomavirus infection
    122095844 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122095844 (Mapk1)
   05135 Yersinia infection
    122095844 (Mapk1)
   05133 Pertussis
    122095844 (Mapk1)
   05152 Tuberculosis
    122095844 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    122095844 (Mapk1)
   05140 Leishmaniasis
    122095844 (Mapk1)
   05142 Chagas disease
    122095844 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122095844 (Mapk1)
   05020 Prion disease
    122095844 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    122095844 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    122095844 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122095844 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122095844 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122095844 (Mapk1)
   04934 Cushing syndrome
    122095844 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122095844 (Mapk1)
   01524 Platinum drug resistance
    122095844 (Mapk1)
   01522 Endocrine resistance
    122095844 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsp01001]
    122095844 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dsp03036]
    122095844 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsp04147]
    122095844 (Mapk1)
Enzymes [BR:dsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     122095844 (Mapk1)
Protein kinases [BR:dsp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   122095844 (Mapk1)
Chromosome and associated proteins [BR:dsp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     122095844 (Mapk1)
Exosome [BR:dsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122095844 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase STATB_N FTA2 Kdo
Other DBs
NCBI-GeneID: 122095844
NCBI-ProteinID: XP_042522069
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKERLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcagcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtgggaccgcgctacaccaatctctcgtacatcggcgagggtgcctacggcatggtgtgc
tctgcttatgataacctcaacaaagttcgagtagctatcaagaaaatcagcccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaagacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaatgaccacatctgctattttctttaccagattcttagagggttaaaatacatc
cattcagctaatgttctgcaccgtgacctcaagccttccaatctgctgctcaataccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagatcatgatcac
acaggcttcctgacagagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtgggatgtatcctggcagag
atgctgtccaataggcccattttcccaggaaagcattatcttgaccaactgaaccatatt
ctgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaggct
agaaactatttgctctctcttccacacaaaaataaagtaccatggaataggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgacattcaacccccacaag
aggattgaagttgaacaggctctggcccacccatatctggagcagtattatgacccgagt
gatgagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gaaaggctcaaggaactcatctttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system