Entry |
|
Symbol |
Vegfa
|
Name |
(RefSeq) vascular endothelial growth factor A
|
KO |
K05448 | vascular endothelial growth factor A |
|
Organism |
dsp Dipodomys spectabilis (banner-tailed kangaroo rat)
|
Pathway |
dsp01521 | EGFR tyrosine kinase inhibitor resistance |
dsp04933 | AGE-RAGE signaling pathway in diabetic complications |
dsp05163 | Human cytomegalovirus infection |
dsp05167 | Kaposi sarcoma-associated herpesvirus infection |
dsp05207 | Chemical carcinogenesis - receptor activation |
dsp05208 | Chemical carcinogenesis - reactive oxygen species |
dsp05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:dsp00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
122101493 (Vegfa)
04014 Ras signaling pathway
122101493 (Vegfa)
04015 Rap1 signaling pathway
122101493 (Vegfa)
04370 VEGF signaling pathway
122101493 (Vegfa)
04066 HIF-1 signaling pathway
122101493 (Vegfa)
04020 Calcium signaling pathway
122101493 (Vegfa)
04151 PI3K-Akt signaling pathway
122101493 (Vegfa)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
122101493 (Vegfa)
09150 Organismal Systems
09152 Endocrine system
04926 Relaxin signaling pathway
122101493 (Vegfa)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
122101493 (Vegfa)
05206 MicroRNAs in cancer
122101493 (Vegfa)
05205 Proteoglycans in cancer
122101493 (Vegfa)
05207 Chemical carcinogenesis - receptor activation
122101493 (Vegfa)
05208 Chemical carcinogenesis - reactive oxygen species
122101493 (Vegfa)
09162 Cancer: specific types
05212 Pancreatic cancer
122101493 (Vegfa)
05211 Renal cell carcinoma
122101493 (Vegfa)
05219 Bladder cancer
122101493 (Vegfa)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
122101493 (Vegfa)
05167 Kaposi sarcoma-associated herpesvirus infection
122101493 (Vegfa)
05165 Human papillomavirus infection
122101493 (Vegfa)
09163 Immune disease
05323 Rheumatoid arthritis
122101493 (Vegfa)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
122101493 (Vegfa)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
122101493 (Vegfa)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
122101493 (Vegfa)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:dsp04052]
122101493 (Vegfa)
00536 Glycosaminoglycan binding proteins [BR:dsp00536]
122101493 (Vegfa)
Cytokines and neuropeptides [BR:dsp04052]
Cytokines
Growth factors (RTK binding)
122101493 (Vegfa)
Glycosaminoglycan binding proteins [BR:dsp00536]
Heparan sulfate / Heparin
Growth factors/receptors
122101493 (Vegfa)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
109 aa
MRIKPHQGQHIGEMSFLQHSKCECRPKKDRARPEKKSVRGKGKGQKRKRKKSRYKCWSVP
CGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
NT seq |
330 nt +upstreamnt +downstreamnt
atgcggatcaaacctcaccaaggccagcacataggagagatgagcttcttacagcacagc
aaatgtgaatgcagaccaaagaaagatagagcaaggccggaaaaaaaatcagtccgagga
aagggaaaggggcaaaaacgaaagcgcaagaaatcccggtataaatgctggagcgttccc
tgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgtaaa
tgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaacgt
acttgcaggtgtgacaagccgaggcggtga |