Entry |
|
Symbol |
Gng13
|
Name |
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
|
KO |
K04547 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 |
|
Organism |
dsp Dipodomys spectabilis (banner-tailed kangaroo rat)
|
Pathway |
dsp04723 | Retrograde endocannabinoid signaling |
dsp05163 | Human cytomegalovirus infection |
dsp05167 | Kaposi sarcoma-associated herpesvirus infection |
dsp05170 | Human immunodeficiency virus 1 infection |
|
Brite |
KEGG Orthology (KO) [BR:dsp00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
122101888 (Gng13)
04371 Apelin signaling pathway
122101888 (Gng13)
04151 PI3K-Akt signaling pathway
122101888 (Gng13)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
122101888 (Gng13)
04081 Hormone signaling
122101888 (Gng13)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
122101888 (Gng13)
09152 Endocrine system
04926 Relaxin signaling pathway
122101888 (Gng13)
09156 Nervous system
04724 Glutamatergic synapse
122101888 (Gng13)
04727 GABAergic synapse
122101888 (Gng13)
04725 Cholinergic synapse
122101888 (Gng13)
04728 Dopaminergic synapse
122101888 (Gng13)
04726 Serotonergic synapse
122101888 (Gng13)
04723 Retrograde endocannabinoid signaling
122101888 (Gng13)
09157 Sensory system
04740 Olfactory transduction
122101888 (Gng13)
04742 Taste transduction
122101888 (Gng13)
09159 Environmental adaptation
04713 Circadian entrainment
122101888 (Gng13)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
122101888 (Gng13)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
122101888 (Gng13)
05163 Human cytomegalovirus infection
122101888 (Gng13)
05167 Kaposi sarcoma-associated herpesvirus infection
122101888 (Gng13)
09165 Substance dependence
05032 Morphine addiction
122101888 (Gng13)
05034 Alcoholism
122101888 (Gng13)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:dsp04031]
122101888 (Gng13)
GTP-binding proteins [BR:dsp04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
122101888 (Gng13)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
67 aa
MEEWDVPQMKKEVESLKYQLAFKREMSSKSIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KAKCAIL |
NT seq |
204 nt +upstreamnt +downstreamnt
atggaggagtgggacgtcccacagatgaagaaagaggtagagagcctcaagtaccagctg
gccttcaagagagagatgtcttccaagagcatccccgagctgctgaagtggattgaggac
gggatccccaaggacccctttctgaaccccgacctgatgaagaacaacccctgggtggag
aaggccaagtgtgccatcctgtga |