| Entry |
|
|---|
| Symbol |
Eif4ebp1
|
|---|
| Name |
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
|
|---|
| KO |
| K07205 | eukaryotic translation initiation factor 4E binding protein 1 |
|
|---|
| Organism |
dsp Dipodomys spectabilis (banner-tailed kangaroo rat)
|
|---|
| Pathway |
| dsp01521 | EGFR tyrosine kinase inhibitor resistance |
| dsp05163 | Human cytomegalovirus infection |
| dsp05168 | Herpes simplex virus 1 infection |
| dsp05207 | Chemical carcinogenesis - receptor activation |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:dsp00001]
09130 Environmental Information Processing
09132 Signal transduction
04012 ErbB signaling pathway
122107645 (Eif4ebp1)
04066 HIF-1 signaling pathway
122107645 (Eif4ebp1)
04151 PI3K-Akt signaling pathway
122107645 (Eif4ebp1)
04152 AMPK signaling pathway
122107645 (Eif4ebp1)
04150 mTOR signaling pathway
122107645 (Eif4ebp1)
09140 Cellular Processes
09143 Cell growth and death
04218 Cellular senescence
122107645 (Eif4ebp1)
09150 Organismal Systems
09152 Endocrine system
04910 Insulin signaling pathway
122107645 (Eif4ebp1)
09149 Aging
04211 Longevity regulating pathway
122107645 (Eif4ebp1)
09160 Human Diseases
09161 Cancer: overview
05207 Chemical carcinogenesis - receptor activation
122107645 (Eif4ebp1)
05231 Choline metabolism in cancer
122107645 (Eif4ebp1)
09162 Cancer: specific types
05221 Acute myeloid leukemia
122107645 (Eif4ebp1)
09172 Infectious disease: viral
05168 Herpes simplex virus 1 infection
122107645 (Eif4ebp1)
05163 Human cytomegalovirus infection
122107645 (Eif4ebp1)
05165 Human papillomavirus infection
122107645 (Eif4ebp1)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
122107645 (Eif4ebp1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:dsp03019]
122107645 (Eif4ebp1)
Messenger RNA biogenesis [BR:dsp03019]
Eukaryotic type
mRNA surveillance and transport factors
Transport factors
eIF4F and regulatory proteins
122107645 (Eif4ebp1)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
Unknown
|
|---|
| AA seq |
118 aa
MSAGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVAKTPPRDLPTIPGVTSPTSDEPPVEASQTHLPNSPEEKRVTGEESQFEMDI |
|---|
| NT seq |
357 nt +upstreamnt +downstreamnt
atgtccgcgggtagcagctgcagccagaccccgagccgggccatccccgccacccgccgg
gtggtcctcggcgacggcgtgcagctgccgcccggggactacagcaccacccccggtggc
acactcttcagcaccaccccgggaggaaccaggatcatctatgaccgcaaattcctgatg
gaatgtcggaactcacctgtggccaaaacgcccccgagggacctgccaaccattcctggg
gtcactagtcctaccagtgacgaaccacctgtggaagctagccaaacccacctgcccaac
agcccagaagaaaagcgggtgactggtgaagagtcacagtttgagatggacatttaa |
|---|
