KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122113510
Entry
122113510         CDS       T07891                                 
Symbol
Rac1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp04010  MAPK signaling pathway
dsp04014  Ras signaling pathway
dsp04015  Rap1 signaling pathway
dsp04024  cAMP signaling pathway
dsp04062  Chemokine signaling pathway
dsp04071  Sphingolipid signaling pathway
dsp04145  Phagosome
dsp04148  Efferocytosis
dsp04151  PI3K-Akt signaling pathway
dsp04310  Wnt signaling pathway
dsp04360  Axon guidance
dsp04370  VEGF signaling pathway
dsp04380  Osteoclast differentiation
dsp04510  Focal adhesion
dsp04517  IgSF CAM signaling
dsp04518  Integrin signaling
dsp04520  Adherens junction
dsp04530  Tight junction
dsp04613  Neutrophil extracellular trap formation
dsp04620  Toll-like receptor signaling pathway
dsp04650  Natural killer cell mediated cytotoxicity
dsp04662  B cell receptor signaling pathway
dsp04664  Fc epsilon RI signaling pathway
dsp04666  Fc gamma R-mediated phagocytosis
dsp04670  Leukocyte transendothelial migration
dsp04722  Neurotrophin signaling pathway
dsp04810  Regulation of actin cytoskeleton
dsp04932  Non-alcoholic fatty liver disease
dsp04933  AGE-RAGE signaling pathway in diabetic complications
dsp04972  Pancreatic secretion
dsp05014  Amyotrophic lateral sclerosis
dsp05020  Prion disease
dsp05022  Pathways of neurodegeneration - multiple diseases
dsp05100  Bacterial invasion of epithelial cells
dsp05132  Salmonella infection
dsp05135  Yersinia infection
dsp05163  Human cytomegalovirus infection
dsp05167  Kaposi sarcoma-associated herpesvirus infection
dsp05169  Epstein-Barr virus infection
dsp05170  Human immunodeficiency virus 1 infection
dsp05200  Pathways in cancer
dsp05203  Viral carcinogenesis
dsp05205  Proteoglycans in cancer
dsp05208  Chemical carcinogenesis - reactive oxygen species
dsp05210  Colorectal cancer
dsp05211  Renal cell carcinoma
dsp05212  Pancreatic cancer
dsp05231  Choline metabolism in cancer
dsp05415  Diabetic cardiomyopathy
dsp05416  Viral myocarditis
dsp05417  Lipid and atherosclerosis
dsp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122113510 (Rac1)
   04014 Ras signaling pathway
    122113510 (Rac1)
   04015 Rap1 signaling pathway
    122113510 (Rac1)
   04310 Wnt signaling pathway
    122113510 (Rac1)
   04370 VEGF signaling pathway
    122113510 (Rac1)
   04071 Sphingolipid signaling pathway
    122113510 (Rac1)
   04024 cAMP signaling pathway
    122113510 (Rac1)
   04151 PI3K-Akt signaling pathway
    122113510 (Rac1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122113510 (Rac1)
   04518 Integrin signaling
    122113510 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    122113510 (Rac1)
   04148 Efferocytosis
    122113510 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122113510 (Rac1)
   04520 Adherens junction
    122113510 (Rac1)
   04530 Tight junction
    122113510 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122113510 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    122113510 (Rac1)
   04620 Toll-like receptor signaling pathway
    122113510 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    122113510 (Rac1)
   04662 B cell receptor signaling pathway
    122113510 (Rac1)
   04664 Fc epsilon RI signaling pathway
    122113510 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    122113510 (Rac1)
   04670 Leukocyte transendothelial migration
    122113510 (Rac1)
   04062 Chemokine signaling pathway
    122113510 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    122113510 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    122113510 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    122113510 (Rac1)
   04380 Osteoclast differentiation
    122113510 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122113510 (Rac1)
   05205 Proteoglycans in cancer
    122113510 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    122113510 (Rac1)
   05203 Viral carcinogenesis
    122113510 (Rac1)
   05231 Choline metabolism in cancer
    122113510 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122113510 (Rac1)
   05212 Pancreatic cancer
    122113510 (Rac1)
   05211 Renal cell carcinoma
    122113510 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    122113510 (Rac1)
   05163 Human cytomegalovirus infection
    122113510 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122113510 (Rac1)
   05169 Epstein-Barr virus infection
    122113510 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122113510 (Rac1)
   05135 Yersinia infection
    122113510 (Rac1)
   05100 Bacterial invasion of epithelial cells
    122113510 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    122113510 (Rac1)
   05020 Prion disease
    122113510 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    122113510 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122113510 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    122113510 (Rac1)
   05415 Diabetic cardiomyopathy
    122113510 (Rac1)
   05416 Viral myocarditis
    122113510 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    122113510 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122113510 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsp04131]
    122113510 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsp04147]
    122113510 (Rac1)
   04031 GTP-binding proteins [BR:dsp04031]
    122113510 (Rac1)
Membrane trafficking [BR:dsp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    122113510 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    122113510 (Rac1)
  Macropinocytosis
   Ras GTPases
    122113510 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    122113510 (Rac1)
Exosome [BR:dsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122113510 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   122113510 (Rac1)
  Exosomal proteins of colorectal cancer cells
   122113510 (Rac1)
  Exosomal proteins of bladder cancer cells
   122113510 (Rac1)
GTP-binding proteins [BR:dsp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    122113510 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 122113510
NCBI-ProteinID: XP_042542421
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgtctgctg
atcagttacaccaccaatgcatttcctggagagtacatccctactgtctttgacaactat
tctgccaatgttatggtagatggaaagccagtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccctctcatatccgcaaacagatgtattcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatccagaa
gtgcgacaccactgtcccaacacccccatcatcctagtgggaacaaaacttgaccttagg
gatgataaagacacgattgagaagctgaaggagaagaagctgacgcccatcacctacccg
caggggttagccatggctaaggagattggtgctgtaaaatacctggagtgctcggctctt
acccagagaggcctcaagacagtgtttgacgaagctatccgtgcggttctctgcccaccc
cccgtcaagaaacggaagagaaaatgcctgctcttgtaa

DBGET integrated database retrieval system