KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122118367
Entry
122118367         CDS       T07891                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp01521  EGFR tyrosine kinase inhibitor resistance
dsp01522  Endocrine resistance
dsp04010  MAPK signaling pathway
dsp04012  ErbB signaling pathway
dsp04014  Ras signaling pathway
dsp04015  Rap1 signaling pathway
dsp04062  Chemokine signaling pathway
dsp04068  FoxO signaling pathway
dsp04071  Sphingolipid signaling pathway
dsp04072  Phospholipase D signaling pathway
dsp04137  Mitophagy - animal
dsp04140  Autophagy - animal
dsp04150  mTOR signaling pathway
dsp04151  PI3K-Akt signaling pathway
dsp04210  Apoptosis
dsp04211  Longevity regulating pathway
dsp04213  Longevity regulating pathway - multiple species
dsp04218  Cellular senescence
dsp04360  Axon guidance
dsp04370  VEGF signaling pathway
dsp04371  Apelin signaling pathway
dsp04540  Gap junction
dsp04550  Signaling pathways regulating pluripotency of stem cells
dsp04625  C-type lectin receptor signaling pathway
dsp04650  Natural killer cell mediated cytotoxicity
dsp04660  T cell receptor signaling pathway
dsp04662  B cell receptor signaling pathway
dsp04664  Fc epsilon RI signaling pathway
dsp04714  Thermogenesis
dsp04720  Long-term potentiation
dsp04722  Neurotrophin signaling pathway
dsp04725  Cholinergic synapse
dsp04726  Serotonergic synapse
dsp04730  Long-term depression
dsp04810  Regulation of actin cytoskeleton
dsp04910  Insulin signaling pathway
dsp04912  GnRH signaling pathway
dsp04915  Estrogen signaling pathway
dsp04916  Melanogenesis
dsp04917  Prolactin signaling pathway
dsp04919  Thyroid hormone signaling pathway
dsp04921  Oxytocin signaling pathway
dsp04926  Relaxin signaling pathway
dsp04929  GnRH secretion
dsp04933  AGE-RAGE signaling pathway in diabetic complications
dsp04935  Growth hormone synthesis, secretion and action
dsp05010  Alzheimer disease
dsp05022  Pathways of neurodegeneration - multiple diseases
dsp05034  Alcoholism
dsp05160  Hepatitis C
dsp05161  Hepatitis B
dsp05163  Human cytomegalovirus infection
dsp05165  Human papillomavirus infection
dsp05166  Human T-cell leukemia virus 1 infection
dsp05167  Kaposi sarcoma-associated herpesvirus infection
dsp05170  Human immunodeficiency virus 1 infection
dsp05200  Pathways in cancer
dsp05203  Viral carcinogenesis
dsp05205  Proteoglycans in cancer
dsp05206  MicroRNAs in cancer
dsp05207  Chemical carcinogenesis - receptor activation
dsp05208  Chemical carcinogenesis - reactive oxygen species
dsp05210  Colorectal cancer
dsp05211  Renal cell carcinoma
dsp05213  Endometrial cancer
dsp05214  Glioma
dsp05215  Prostate cancer
dsp05216  Thyroid cancer
dsp05218  Melanoma
dsp05219  Bladder cancer
dsp05220  Chronic myeloid leukemia
dsp05221  Acute myeloid leukemia
dsp05223  Non-small cell lung cancer
dsp05224  Breast cancer
dsp05225  Hepatocellular carcinoma
dsp05226  Gastric cancer
dsp05230  Central carbon metabolism in cancer
dsp05231  Choline metabolism in cancer
dsp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dsp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122118367 (Nras)
   04012 ErbB signaling pathway
    122118367 (Nras)
   04014 Ras signaling pathway
    122118367 (Nras)
   04015 Rap1 signaling pathway
    122118367 (Nras)
   04370 VEGF signaling pathway
    122118367 (Nras)
   04371 Apelin signaling pathway
    122118367 (Nras)
   04068 FoxO signaling pathway
    122118367 (Nras)
   04072 Phospholipase D signaling pathway
    122118367 (Nras)
   04071 Sphingolipid signaling pathway
    122118367 (Nras)
   04151 PI3K-Akt signaling pathway
    122118367 (Nras)
   04150 mTOR signaling pathway
    122118367 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122118367 (Nras)
   04137 Mitophagy - animal
    122118367 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    122118367 (Nras)
   04218 Cellular senescence
    122118367 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    122118367 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    122118367 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122118367 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    122118367 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    122118367 (Nras)
   04660 T cell receptor signaling pathway
    122118367 (Nras)
   04662 B cell receptor signaling pathway
    122118367 (Nras)
   04664 Fc epsilon RI signaling pathway
    122118367 (Nras)
   04062 Chemokine signaling pathway
    122118367 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122118367 (Nras)
   04929 GnRH secretion
    122118367 (Nras)
   04912 GnRH signaling pathway
    122118367 (Nras)
   04915 Estrogen signaling pathway
    122118367 (Nras)
   04917 Prolactin signaling pathway
    122118367 (Nras)
   04921 Oxytocin signaling pathway
    122118367 (Nras)
   04926 Relaxin signaling pathway
    122118367 (Nras)
   04935 Growth hormone synthesis, secretion and action
    122118367 (Nras)
   04919 Thyroid hormone signaling pathway
    122118367 (Nras)
   04916 Melanogenesis
    122118367 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    122118367 (Nras)
   04726 Serotonergic synapse
    122118367 (Nras)
   04720 Long-term potentiation
    122118367 (Nras)
   04730 Long-term depression
    122118367 (Nras)
   04722 Neurotrophin signaling pathway
    122118367 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    122118367 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    122118367 (Nras)
   04213 Longevity regulating pathway - multiple species
    122118367 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    122118367 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122118367 (Nras)
   05206 MicroRNAs in cancer
    122118367 (Nras)
   05205 Proteoglycans in cancer
    122118367 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    122118367 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    122118367 (Nras)
   05203 Viral carcinogenesis
    122118367 (Nras)
   05230 Central carbon metabolism in cancer
    122118367 (Nras)
   05231 Choline metabolism in cancer
    122118367 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122118367 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122118367 (Nras)
   05225 Hepatocellular carcinoma
    122118367 (Nras)
   05226 Gastric cancer
    122118367 (Nras)
   05214 Glioma
    122118367 (Nras)
   05216 Thyroid cancer
    122118367 (Nras)
   05221 Acute myeloid leukemia
    122118367 (Nras)
   05220 Chronic myeloid leukemia
    122118367 (Nras)
   05218 Melanoma
    122118367 (Nras)
   05211 Renal cell carcinoma
    122118367 (Nras)
   05219 Bladder cancer
    122118367 (Nras)
   05215 Prostate cancer
    122118367 (Nras)
   05213 Endometrial cancer
    122118367 (Nras)
   05224 Breast cancer
    122118367 (Nras)
   05223 Non-small cell lung cancer
    122118367 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122118367 (Nras)
   05170 Human immunodeficiency virus 1 infection
    122118367 (Nras)
   05161 Hepatitis B
    122118367 (Nras)
   05160 Hepatitis C
    122118367 (Nras)
   05163 Human cytomegalovirus infection
    122118367 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122118367 (Nras)
   05165 Human papillomavirus infection
    122118367 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122118367 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    122118367 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    122118367 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122118367 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    122118367 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122118367 (Nras)
   01522 Endocrine resistance
    122118367 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsp04131]
    122118367 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsp04147]
    122118367 (Nras)
   04031 GTP-binding proteins [BR:dsp04031]
    122118367 (Nras)
Membrane trafficking [BR:dsp04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    122118367 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    122118367 (Nras)
Exosome [BR:dsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122118367 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   122118367 (Nras)
  Exosomal proteins of breast cancer cells
   122118367 (Nras)
  Exosomal proteins of colorectal cancer cells
   122118367 (Nras)
GTP-binding proteins [BR:dsp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    122118367 (Nras)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 122118367
NCBI-ProteinID: XP_042548262
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTRG
CMGLPCVLM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagcaggtggcgttgggaagagcgcgctgacc
atccagctgatccagaaccacttcgtggatgagtatgaccctaccatagaggattcttac
cgaaagcaggtagtgatagacggagaaacctgtctgctcgacatcctggacaccgctgga
caggaggagtacagcgctatgagggaccagtatatgaggacaggcgagggcttcctctgc
gtgtttgctattaataacagcaagtcatttgcagacatcaacctgtacagggagcagatt
aaacgagtgaaggactccgaggatgtgcccatggtgctggtggggaacaaatgtgacttg
cccacaaggacagtggacacaaaacaagcccacgaactggccaagagctacgggatccca
ttcatcgaaacctcagccaagaccagacagggtgtcgaggatgccttttacaccctggtg
agagagatccgccagtaccggatgaaaaagctcaacagcagtgatgacgggacccggggc
tgcatgggcttgccttgtgtgctgatgtaa

DBGET integrated database retrieval system