KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122124059
Entry
122124059         CDS       T07891                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp04014  Ras signaling pathway
dsp04015  Rap1 signaling pathway
dsp04020  Calcium signaling pathway
dsp04022  cGMP-PKG signaling pathway
dsp04024  cAMP signaling pathway
dsp04070  Phosphatidylinositol signaling system
dsp04114  Oocyte meiosis
dsp04218  Cellular senescence
dsp04261  Adrenergic signaling in cardiomyocytes
dsp04270  Vascular smooth muscle contraction
dsp04371  Apelin signaling pathway
dsp04625  C-type lectin receptor signaling pathway
dsp04713  Circadian entrainment
dsp04720  Long-term potentiation
dsp04722  Neurotrophin signaling pathway
dsp04728  Dopaminergic synapse
dsp04740  Olfactory transduction
dsp04744  Phototransduction
dsp04750  Inflammatory mediator regulation of TRP channels
dsp04910  Insulin signaling pathway
dsp04912  GnRH signaling pathway
dsp04915  Estrogen signaling pathway
dsp04916  Melanogenesis
dsp04921  Oxytocin signaling pathway
dsp04922  Glucagon signaling pathway
dsp04924  Renin secretion
dsp04925  Aldosterone synthesis and secretion
dsp04970  Salivary secretion
dsp04971  Gastric acid secretion
dsp05010  Alzheimer disease
dsp05012  Parkinson disease
dsp05022  Pathways of neurodegeneration - multiple diseases
dsp05031  Amphetamine addiction
dsp05034  Alcoholism
dsp05133  Pertussis
dsp05152  Tuberculosis
dsp05163  Human cytomegalovirus infection
dsp05167  Kaposi sarcoma-associated herpesvirus infection
dsp05170  Human immunodeficiency virus 1 infection
dsp05200  Pathways in cancer
dsp05214  Glioma
dsp05417  Lipid and atherosclerosis
dsp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    122124059
   04015 Rap1 signaling pathway
    122124059
   04371 Apelin signaling pathway
    122124059
   04020 Calcium signaling pathway
    122124059
   04070 Phosphatidylinositol signaling system
    122124059
   04024 cAMP signaling pathway
    122124059
   04022 cGMP-PKG signaling pathway
    122124059
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    122124059
   04218 Cellular senescence
    122124059
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    122124059
  09152 Endocrine system
   04910 Insulin signaling pathway
    122124059
   04922 Glucagon signaling pathway
    122124059
   04912 GnRH signaling pathway
    122124059
   04915 Estrogen signaling pathway
    122124059
   04921 Oxytocin signaling pathway
    122124059
   04916 Melanogenesis
    122124059
   04924 Renin secretion
    122124059
   04925 Aldosterone synthesis and secretion
    122124059
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122124059
   04270 Vascular smooth muscle contraction
    122124059
  09154 Digestive system
   04970 Salivary secretion
    122124059
   04971 Gastric acid secretion
    122124059
  09156 Nervous system
   04728 Dopaminergic synapse
    122124059
   04720 Long-term potentiation
    122124059
   04722 Neurotrophin signaling pathway
    122124059
  09157 Sensory system
   04744 Phototransduction
    122124059
   04740 Olfactory transduction
    122124059
   04750 Inflammatory mediator regulation of TRP channels
    122124059
  09159 Environmental adaptation
   04713 Circadian entrainment
    122124059
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122124059
  09162 Cancer: specific types
   05214 Glioma
    122124059
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    122124059
   05163 Human cytomegalovirus infection
    122124059
   05167 Kaposi sarcoma-associated herpesvirus infection
    122124059
  09171 Infectious disease: bacterial
   05133 Pertussis
    122124059
   05152 Tuberculosis
    122124059
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122124059
   05012 Parkinson disease
    122124059
   05022 Pathways of neurodegeneration - multiple diseases
    122124059
  09165 Substance dependence
   05031 Amphetamine addiction
    122124059
   05034 Alcoholism
    122124059
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122124059
   05418 Fluid shear stress and atherosclerosis
    122124059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsp01009]
    122124059
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsp04131]
    122124059
   03036 Chromosome and associated proteins [BR:dsp03036]
    122124059
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsp04147]
    122124059
Protein phosphatases and associated proteins [BR:dsp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     122124059
Membrane trafficking [BR:dsp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    122124059
Chromosome and associated proteins [BR:dsp03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     122124059
Exosome [BR:dsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   122124059
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C UPF0154 EFhand_Ca_insen DUF1103 SPARC_Ca_bdg SPEF2_C Caleosin TerB Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 122124059
NCBI-ProteinID: XP_042554628
LinkDB
Position
Unknown
AA seq 139 aa
MADQLTEEQTAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGAIDFPEFLTIMARKMKDTDSEEEIREAFRVFDKDGNGYVVQQSFATDEEVDEMIRAAG
IDGDSQVNYEEFVQMMTAK
NT seq 420 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagagcagactgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggaactataacaacaaaggaactgggaactgtaatgaggtctctt
gggcagaatcccacagaagcagaattacaggacatgattaatgaagtagatgccgatggt
aatggcgcaattgacttccctgaatttctgacaataatggcaagaaaaatgaaagatacc
gacagtgaagaagaaatcagagaagcattccgtgtgtttgataaggatggcaatggttat
gtagtgcagcagagctttgccacagatgaagaggttgatgaaatgatcagggcagcaggt
attgatggtgatagtcaagtaaactatgaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system